Protein Classes
Protein Summary
The H2 subclass of histamine receptors mediates gastric acid secretion. Also appears to regulate gastrointestinal motility and intestinal secretion. Possible role in regulating cell growth and differentiation. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and, through a separate G protein-dependent mechanism, the phosphoinositide/protein kinase (PKC) signaling pathway (By similarity). Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. Histamine receptor H2 belongs to the family 1 of G protein-coupled receptors. It is an integral membrane protein and stimulates gastric acid secretion. It also regulates gastrointestinal motility and intestinal secretion and is thought to be involved in regulating cell growth and differentiation. Alternatively spliced transcript variants encoding different isoforms have been foun ...more
- ENST00000231683
- ENSP00000231683
- ENSG00000113749
- ENST00000377291
- ENSP00000366506
- H2R
- HH2R
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
biological process | 0.86 | ||
drug | 0.79 | ||
transcription factor | 0.74 | ||
molecular function | 0.7 | ||
ligand (chemical) | 0.66 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 1601.77 (req: < 5)
Gene RIFs: 49 (req: <= 3)
Antibodies: 319 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 1601.77 (req: >= 5)
Gene RIFs: 49 (req: > 3)
Antibodies: 319 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 18
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligands: 31
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drugs: 11
Approved Drugs (11)
1 – 10 of 11
Active Ligands (31)
1 – 10 of 31
Pathways (16)
Reactome (8)
KEGG (3)
PathwayCommons (2)
WikiPathways (3)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 8
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Amine ligand-binding receptors | ||||
Reactome | Class A/1 (Rhodopsin-like receptors) | ||||
Reactome | G alpha (s) signalling events | ||||
Reactome | GPCR downstream signalling | ||||
Reactome | GPCR ligand binding | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Amine ligand-binding receptors | ||||
Class A/1 (Rhodopsin-like receptors) | ||||
G alpha (s) signalling events | ||||
GPCR downstream signalling | ||||
GPCR ligand binding | ||||
Gene Ontology Terms (21)
Functions (4)
Components (3)
Processes (14)
Items per page:
10
1 – 4 of 4
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Protein-Protein Interactions (158)
1 – 10 of 158
SCT
Novelty: 0.00076973
Score: 0.935
Data Source: STRINGDB
PTGER4
Family: GPCR
Novelty: 0.00101275
Score: 0.925
Data Source: STRINGDB
PTH
Novelty: 0.00003793
Score: 0.925
Data Source: STRINGDB
CALCA
Novelty: 0.00012558
Score: 0.923
Data Source: STRINGDB
CALCA
Novelty: 0.00012558
Score: 0.923
Data Source: STRINGDB
GPR27
Family: GPCR
Novelty: 0.22950594
Score: 0.923
Data Source: STRINGDB
ADCYAP1R1
Family: GPCR
Novelty: 0.00922226
Score: 0.921
Data Source: STRINGDB
VIP
Novelty: 0.00028207
Score: 0.92
Data Source: STRINGDB
GNAS
Novelty: 0.00259764
Score: 0.916
Data Source: STRINGDB
GNAS
Novelty: 0.00259764
Score: 0.916
Data Source: STRINGDB
Publication Statistics
PubMed Score 1601.77
PubMed score by year
PubTator Score 1054.04
PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSLAITDLLLGLL
1-70
VLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAVMDPLRYPVLVTPVRVAISLV
70-140
LIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNEVYGLVDGLVTFYLPLLIMCITYYRIFKVAR
140-210
DQAKRINHISSWKAATIREHKATVTLAAVMGAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYAN
210-280
SALNPILYAALNRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEV
280-350
TAPQGATDR
350-359
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSLAITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAVMDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNEVYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVMGAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
Find similar targets by: