You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
HRH2
Histamine H2 receptor

Protein Summary
Description
The H2 subclass of histamine receptors mediates gastric acid secretion. Also appears to regulate gastrointestinal motility and intestinal secretion. Possible role in regulating cell growth and differentiation. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and, through a separate G protein-dependent mechanism, the phosphoinositide/protein kinase (PKC) signaling pathway (By similarity). Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. Histamine receptor H2 belongs to the family 1 of G protein-coupled receptors. It is an integral membrane protein and stimulates gastric acid secretion. It also regulates gastrointestinal motility and intestinal secretion and is thought to be involved in regulating cell growth and differentiation. Alternatively spliced transcript variants encoding different isoforms have been foun ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000231683
  • ENSP00000231683
  • ENSG00000113749
  • ENST00000377291
  • ENSP00000366506

Symbol
  • H2R
  • HH2R
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.86
drug
0.79
transcription factor
0.74
molecular function
0.7
ligand (chemical)
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1601.77   (req: < 5)
Gene RIFs: 49   (req: <= 3)
Antibodies: 319   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1601.77   (req: >= 5)
Gene RIFs: 49   (req: > 3)
Antibodies: 319   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 31
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 11
Pathways (16)
Amine ligand-binding receptors (R-HSA-375280)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Amine ligand-binding receptors
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (s) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Name
Explore in Pharos
Explore in Source
Amine ligand-binding receptors
Class A/1 (Rhodopsin-like receptors)
G alpha (s) signalling events
GPCR downstream signalling
GPCR ligand binding
Gene Ontology Terms (21)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (158)
1 – 10 of 158
SCT
Tbio
Novelty: 0.00076973
Score: 0.935
Data Source: STRINGDB
PTGER4
Tclin
Family: GPCR
Novelty: 0.00101275
Score: 0.925
Data Source: STRINGDB
PTH
Tbio
Novelty: 0.00003793
Score: 0.925
Data Source: STRINGDB
CALCA
Tclin
Novelty: 0.00012558
Score: 0.923
Data Source: STRINGDB
CALCA
Tbio
Novelty: 0.00012558
Score: 0.923
Data Source: STRINGDB
GPR27
Tdark
Family: GPCR
Novelty: 0.22950594
Score: 0.923
Data Source: STRINGDB
ADCYAP1R1
Tchem
Family: GPCR
Novelty: 0.00922226
Score: 0.921
Data Source: STRINGDB
VIP
Tbio
Novelty: 0.00028207
Score: 0.92
Data Source: STRINGDB
GNAS
Tbio
Novelty: 0.00259764
Score: 0.916
Data Source: STRINGDB
GNAS
Tbio
Novelty: 0.00259764
Score: 0.916
Data Source: STRINGDB
Publication Statistics
PubMed Score  1601.77

PubMed score by year
PubTator Score  1054.04

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSLAITDLLLGLL
1-70
VLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAVMDPLRYPVLVTPVRVAISLV
70-140
LIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNEVYGLVDGLVTFYLPLLIMCITYYRIFKVAR
140-210
DQAKRINHISSWKAATIREHKATVTLAAVMGAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYAN
210-280
SALNPILYAALNRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEV
280-350
TAPQGATDR
350-359
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSLAITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAVMDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNEVYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVMGAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR