You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
VAMP1
Vesicle-associated membrane protein 1

Protein Summary
Description
Involved in the targeting and/or fusion of transport vesicles to their target membrane. Synapotobrevins, syntaxins, and the synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Mutations in this gene are associated with autosomal dominant spastic ataxia 1. Multiple alternative splice variants have been described, but the full-length nature of some variants has not been defined. [provided by RefSeq, Jul 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000361716
  • ENSP00000355122
  • ENSG00000139190
  • ENST00000396308
  • ENSP00000379602
  • ENST00000400911
  • ENSP00000383702

Symbol
  • SYB1
  • SYB1
  • CMS25
  • SPAX1
  • VAMP-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cellular component
0.92
histone modification site profile
0.81
transcription factor binding site profile
0.77
microRNA
0.73
small molecule perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 59.57   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 356   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 59.57   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 356   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (29)
Disease (R-HSA-1643685)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Disease
Reactome
Infectious disease
Reactome
Neurotoxicity of clostridium toxins
Reactome
Toxicity of botulinum toxin type D (BoNT/D)
Reactome
Toxicity of botulinum toxin type F (BoNT/F)
Name
Explore in Pharos
Explore in Source
Disease
Infectious disease
Neurotoxicity of clostridium toxins
Toxicity of botulinum toxin type D (BoNT/D)
Toxicity of botulinum toxin type F (BoNT/F)
Gene Ontology Terms (15)
Items per page:
10
1 – 10 of 12
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (119)
1 – 10 of 119
SNAP25
Tclin
Novelty: 0.0020914
Score: 0.986
Data Source: STRINGDB
VAPA
Tbio
Novelty: 0.0022428
Score: 0.97
Data Source: STRINGDB
STX1A
Tbio
Novelty: 0.00128938
Score: 0.966
Data Source: STRINGDB
STX1B
Tbio
Novelty: 0.0148918
Score: 0.948
Data Source: STRINGDB
VAMP3
Tbio
Novelty: 0.00974462
Score: 0.945
Data Source: STRINGDB
SNAP23
Tbio
Novelty: 0.00732279
Score: 0.943
Data Source: STRINGDB
STX4
Tbio
Novelty: 0.01072491
Score: 0.938
Data Source: STRINGDB
VTI1B
Tbio
Novelty: 0.01384977
Score: 0.903
Data Source: STRINGDB
CPLX1
Tbio
Novelty: 0.01111396
Score: 0.882
Data Source: STRINGDB
STX3
Tbio
Novelty: 0.01589793
Score: 0.877
Data Source: STRINGDB
Publication Statistics
PubMed Score  59.57

PubMed score by year
PubTator Score  39.87

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRAD
1-70
ALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT
70-118
MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT