You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
EIF4B
Eukaryotic translation initiation factor 4B

Protein Summary
Description
Required for the binding of mRNA to ribosomes. Functions in close association with EIF4-F and EIF4-A. Binds near the 5'-terminal cap of mRNA in presence of EIF-4F and ATP. Promotes the ATPase activity and the ATP-dependent RNA unwinding activity of both EIF4-A and EIF4-F.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000262056
  • ENSP00000262056
  • ENSG00000063046
  • ENST00000416762
  • ENSP00000412530

Symbol
  • EIF-4B
  • PRO1843
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug perturbation
1
transcription factor perturbation
1
disease perturbation
0.99
kinase perturbation
0.99
interacting protein
0.98


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 104.82   (req: < 5)
Gene RIFs: 24   (req: <= 3)
Antibodies: 757   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 104.82   (req: >= 5)
Gene RIFs: 24   (req: > 3)
Antibodies: 757   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (25)
Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S (R-HSA-72662)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S
Reactome
Cap-dependent Translation Initiation
Reactome
Deadenylation of mRNA
Reactome
Deadenylation-dependent mRNA decay
Reactome
Eukaryotic Translation Initiation
Name
Explore in Pharos
Explore in Source
Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S
Cap-dependent Translation Initiation
Deadenylation of mRNA
Deadenylation-dependent mRNA decay
Eukaryotic Translation Initiation
Gene Ontology Terms (13)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (353)
1 – 10 of 353
RBM12B
Tdark
Novelty: 7.74193548
p_int: 1
Data Source: BioPlex
NIF3L1
Tbio
Novelty: 0.21052632
p_int: 0.999443417
p_ni: 0.000556583
Data Source: BioPlex
NCOA5
Tbio
Novelty: 0.07301749
p_int: 0.982891694
p_ni: 0.017078213
p_wrong: 0.000030093
Score: 0.181
Data Source: BioPlex,STRINGDB
EIF4G1
Tbio
Novelty: 0.00219215
Score: 0.999
Data Source: Reactome,STRINGDB
EIF4A1
Tchem
Novelty: 0.0043238
Score: 0.999
Data Source: Reactome,STRINGDB
RPS6
Tbio
Novelty: 0.00155552
Score: 0.998
Data Source: STRINGDB
EIF4A2
Tbio
Novelty: 0.00471357
Score: 0.998
Data Source: Reactome,STRINGDB
EIF4E
Tchem
Novelty: 0.00088513
Score: 0.996
Data Source: Reactome,STRINGDB
EIF3A
Tbio
Novelty: 0.00483199
Score: 0.996
Data Source: STRINGDB
PABPC1
Tbio
Novelty: 0.002455
Score: 0.995
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  104.82

PubMed score by year
PubTator Score  107.07

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGDVSTTWHSNDDDVYRAPPIDR
1-70
SILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFG
70-140
YAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWRARPATDSFDD
140-210
YPPRRGDDSFGDKYRDRYDSDRYRDGYRDGYRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRA
210-280
FGSGYRRDDDYRGGGDRYEDRYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSAS
280-350
TSQSTRAASIFGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLERRPRERHPSWRSEETQERERSRT
350-420
GSESSQTGTSTTSSRNARRRESEKSLENETLNKEEDCHSPTSKPPKPDQPLKVMPAPPPKENAWVKRSSN
420-490
PPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQTGNSSRGPGDGGNRDHWKESD
490-560
RKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSVDGEDENEGEDYAE
560-611
MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGDVSTTWHSNDDDVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWRARPATDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDGYRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYEDRYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSASTSQSTRAASIFGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLERRPRERHPSWRSEETQERERSRTGSESSQTGTSTTSSRNARRRESEKSLENETLNKEEDCHSPTSKPPKPDQPLKVMPAPPPKENAWVKRSSNPPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQTGNSSRGPGDGGNRDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSVDGEDENEGEDYAE