You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PTPRE
Receptor-type tyrosine-protein phosphatase epsilon

Protein Summary
Description
Isoform 1 plays a critical role in signaling transduction pathways and phosphoprotein network topology in red blood cells. May play a role in osteoclast formation and function (By similarity). Isoform 2 acts as a negative regulator of insulin receptor (IR) signaling in skeletal muscle. Regulates insulin-induced tyrosine phosphorylation of insulin receptor (IR) and insulin receptor substrate 1 (IRS-1), phosphorylation of protein kinase B and glycogen synthase kinase-3 and insulin induced stimulation of glucose uptake (By similarity). Isoform 1 and isoform 2 act as a negative regulator of FceRI-mediated signal transduction leading to cytokine production and degranulation, most likely by acting at the level of SYK to affect downstream events such as phosphorylation of SLP76 and LAT and mobilization of Ca(2+). The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000254667
  • ENSP00000254667
  • ENSG00000132334
  • ENST00000306042
  • ENSP00000303350

Symbol
  • PTPE
  • HPTPE
  • R-PTP-EPSILON
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.91
disease perturbation
0.87
kinase perturbation
0.84
transcription factor binding site profile
0.76
gene perturbation
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 65.15   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 455   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 65.15   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 455   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Protein-Protein Interactions (46)
1 – 10 of 46
PTPRA
Tchem
Family: Enzyme
Novelty: 0.01725567
p_int: 1
Score: 0.529
Data Source: BioPlex,STRINGDB
ATP6V0C
Tbio
Family: Enzyme
Novelty: 0.01276499
p_int: 0.808282272
p_ni: 0.069637285
p_wrong: 0.122080442
Score: 0.369
Data Source: BioPlex,STRINGDB
JAK1
Tclin
Family: Kinase
Novelty: 0.00136831
Score: 0.918
Data Source: STRINGDB
TYK2
Tclin
Family: Kinase
Novelty: 0.00331363
Score: 0.914
Data Source: STRINGDB
IL6R
Tclin
Novelty: 0.00270567
Score: 0.904
Data Source: STRINGDB
IL6ST
Tclin
Novelty: 0.01731532
Score: 0.903
Data Source: STRINGDB
IL6
Tclin
Novelty: 0.00002829
Score: 0.901
Data Source: STRINGDB
LMO4
Tbio
Novelty: 0.08518694
Score: 0.9
Data Source: STRINGDB
SLITRK2
Tbio
Novelty: 0.28442146
Score: 0.73
Data Source: STRINGDB
SLITRK1
Tbio
Novelty: 0.00164248
Score: 0.73
Data Source: STRINGDB
Publication Statistics
PubMed Score  65.15

PubMed score by year
PubTator Score  12.68

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEPLCPLLLVGFSLPLARALRGNETTADSNETTTTSGPPDPGASQPLLAWLLLPLLLLLLVLLLAAYFFR
1-70
FRKQRKAVVSTSDKKMPNGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFN
70-140
SLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKEKNKFIAAQGP
140-210
KQETVNDFWRMVWEQKSATIVMLTNLKERKEEKCHQYWPDQGCWTYGNIRVCVEDCVVLVDYTIRKFCIQ
210-280
PQLPDGCKAPRLVSQLHFTSWPDFGVPFTPIGMLKFLKKVKTLNPVHAGPIVVHCSAGVGRTGTFIVIDA
280-350
MMAMMHAEQKVDVFEFVSRIRNQRPQMVQTDMQYTFIYQALLEYYLYGDTELDVSSLEKHLQTMHGTTTH
350-420
FDKIGLEEEFRKLTNVRIMKENMRTGNLPANMKKARVIQIIPYDFNRVILSMKRGQEYTDYINASFIDGY
420-490
RQKDYFIATQGPLAHTVEDFWRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTL
490-560
SEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGIPAEGKGMIDLIAAVQKQQQQTGNHPITVHC
560-630
SAGAGRTGTFIALSNILERVKAEGLLDVFQAVKSLRLQRPHMVQTLEQYEFCYKVVQDFIDIFSDYANFK
630-700
MEPLCPLLLVGFSLPLARALRGNETTADSNETTTTSGPPDPGASQPLLAWLLLPLLLLLLVLLLAAYFFRFRKQRKAVVSTSDKKMPNGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKEKNKFIAAQGPKQETVNDFWRMVWEQKSATIVMLTNLKERKEEKCHQYWPDQGCWTYGNIRVCVEDCVVLVDYTIRKFCIQPQLPDGCKAPRLVSQLHFTSWPDFGVPFTPIGMLKFLKKVKTLNPVHAGPIVVHCSAGVGRTGTFIVIDAMMAMMHAEQKVDVFEFVSRIRNQRPQMVQTDMQYTFIYQALLEYYLYGDTELDVSSLEKHLQTMHGTTTHFDKIGLEEEFRKLTNVRIMKENMRTGNLPANMKKARVIQIIPYDFNRVILSMKRGQEYTDYINASFIDGYRQKDYFIATQGPLAHTVEDFWRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGIPAEGKGMIDLIAAVQKQQQQTGNHPITVHCSAGAGRTGTFIALSNILERVKAEGLLDVFQAVKSLRLQRPHMVQTLEQYEFCYKVVQDFIDIFSDYANFK