You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
LHCGR
Lutropin-choriogonadotropic hormone receptor

Protein Summary
Description
Receptor for lutropin-choriogonadotropic hormone (PubMed:11847099). The activity of this receptor is mediated by G proteins which activate adenylate cyclase (PubMed:11847099). This gene encodes the receptor for both luteinizing hormone and choriogonadotropin. This receptor belongs to the G-protein coupled receptor 1 family, and its activity is mediated by G proteins which activate adenylate cyclase. Mutations in this gene result in disorders of male secondary sexual character development, including familial male precocious puberty, also known as testotoxicosis, hypogonadotropic hypogonadism, Leydig cell adenoma with precocious puberty, and male pseudohermaphtoditism with Leydig cell hypoplasia. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000294954
  • ENSP00000294954
  • ENSG00000138039

Symbol
  • LCGR
  • LGR2
  • LHRHR
  • HHG
  • LHR
  • LCGR
  • LGR2
  • ULG5
  • LHRHR
  • LSH-R
  • LH/CGR
  • LH/CG-R
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.85
gene perturbation
0.84
biological process
0.83
phenotype
0.75
cellular component
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 352.58   (req: < 5)
Gene RIFs: 162   (req: <= 3)
Antibodies: 559   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 352.58   (req: >= 5)
Gene RIFs: 162   (req: > 3)
Antibodies: 559   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 19
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Active Ligands (1)
1 – 1 of 1
CHEMBL246321
chemical structure image
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (15)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (s) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Hormone ligand-binding receptors
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
G alpha (s) signalling events
GPCR downstream signalling
GPCR ligand binding
Hormone ligand-binding receptors
Gene Ontology Terms (22)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Protein-Protein Interactions (207)
1 – 10 of 207
LHB
Tbio
Novelty: 0.00250324
Score: 0.975
Data Source: Reactome,STRINGDB
INSL3
Tbio
Novelty: 0.00467497
Score: 0.962
Data Source: STRINGDB
CGA
Tbio
Novelty: 0.00200677
Score: 0.96
Data Source: Reactome,STRINGDB
GNAS
Tbio
Novelty: 0.00259764
Score: 0.959
Data Source: STRINGDB
GNAS
Tbio
Novelty: 0.00259764
Score: 0.959
Data Source: STRINGDB
GNAS
Tbio
Novelty: 0.00259764
Score: 0.959
Data Source: STRINGDB
GNAS
Tbio
Novelty: 0.00259764
Score: 0.959
Data Source: STRINGDB
FSHB
Tbio
Novelty: 0.00622649
Score: 0.954
Data Source: STRINGDB
ARRB2
Tbio
Novelty: 0.00180049
Score: 0.953
Data Source: STRINGDB
AVPR2
Tclin
Family: GPCR
Novelty: 0.00044183
Score: 0.945
Data Source: STRINGDB
Publication Statistics
PubMed Score  352.58

PubMed score by year
PubTator Score  937.76

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MKQRFSALQLLKLLLLLQPPLPRALREALCPEPCNCVPDGALRCPGPTAGLTRLSLAYLPVKVIPSQAFR
1-70
GLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSICNTGIRKFPD
70-140
VTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTSLELKENVHL
140-210
EKMHNGAFRGATGPKTLDISSTKLQALPSYGLESIQRLIATSSYSLKKLPSRETFVNLLEATLTYPSHCC
210-280
AFRNLPTKEQNFSHSISENFSKQCESTVRKVNNKTLYSSMLAESELSGWDYEYGFCLPKTPRCAPEPDAF
280-350
NPCEDIMGYDFLRVLIWLINILAIMGNMTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDS
350-420
QTKGQYYNHAIDWQTGSGCSTAGFFTVFASELSVYTLTVITLERWHTITYAIHLDQKLRLRHAILIMLGG
420-490
WLFSSLIAMLPLVGVSNYMKVSICFPMDVETTLSQVYILTILILNVVAFFIICACYIKIYFAVRNPELMA
490-560
TNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKVPLITVTNSKVLLVLFYPINSCANPFLYAIFTKTF
560-630
QRDFFLLLSKFGCCKRRAELYRRKDFSAYTSNCKNGFTGSNKPSQSTLKLSTLHCQGTALLDKTRYTEC
630-699
MKQRFSALQLLKLLLLLQPPLPRALREALCPEPCNCVPDGALRCPGPTAGLTRLSLAYLPVKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSICNTGIRKFPDVTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFRGATGPKTLDISSTKLQALPSYGLESIQRLIATSSYSLKKLPSRETFVNLLEATLTYPSHCCAFRNLPTKEQNFSHSISENFSKQCESTVRKVNNKTLYSSMLAESELSGWDYEYGFCLPKTPRCAPEPDAFNPCEDIMGYDFLRVLIWLINILAIMGNMTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDSQTKGQYYNHAIDWQTGSGCSTAGFFTVFASELSVYTLTVITLERWHTITYAIHLDQKLRLRHAILIMLGGWLFSSLIAMLPLVGVSNYMKVSICFPMDVETTLSQVYILTILILNVVAFFIICACYIKIYFAVRNPELMATNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKVPLITVTNSKVLLVLFYPINSCANPFLYAIFTKTFQRDFFLLLSKFGCCKRRAELYRRKDFSAYTSNCKNGFTGSNKPSQSTLKLSTLHCQGTALLDKTRYTEC