Protein Summary
Reversible hydration of carbon dioxide. May stimulate the sodium/bicarbonate transporter activity of SLC4A4 that acts in pH homeostasis. It is essential for acid overload removal from the retina and retina epithelium, and acid release in the choriocapillaris in the choroid. Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This gene encodes a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and proximal renal tubules. Its exact function is not known; however, it may have a role in inherited renal abnormalities of bicarbonate tra ...more
- ENST00000300900
- ENSP00000300900
- ENSG00000167434
- ENST00000586876
- ENSP00000467465
- CAIV
- Car4
- RP17
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
disease perturbation | 0.96 | ||
transcription factor perturbation | 0.96 | ||
gene perturbation | 0.94 | ||
PubMedID | 0.82 | ||
drug | 0.77 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 1591.17 (req: < 5)
Gene RIFs: 21 (req: <= 3)
Antibodies: 282 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 1591.17 (req: >= 5)
Gene RIFs: 21 (req: > 3)
Antibodies: 282 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 3
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligands: 256
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drugs: 15
Approved Drugs (15)
1 – 10 of 15
Active Ligands (256)
1 – 10 of 256
Protein Data Bank (10)
1 – 5 of 10
PDB Structure Id | Ligand | Method | Resolution (Ã…) | M.W. (kDa) | Pub Year | Title |
---|
PDB Structure Id | M.W. | Resolution | Pub Year |
---|
Pathways (9)
Reactome (6)
KEGG (3)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 6
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Erythrocytes take up carbon dioxide and release oxygen | ||||
Reactome | Erythrocytes take up oxygen and release carbon dioxide | ||||
Reactome | Metabolism | ||||
Reactome | O2/CO2 exchange in erythrocytes | ||||
Reactome | Reversible hydration of carbon dioxide | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Erythrocytes take up carbon dioxide and release oxygen | ||||
Erythrocytes take up oxygen and release carbon dioxide | ||||
Metabolism | ||||
O2/CO2 exchange in erythrocytes | ||||
Reversible hydration of carbon dioxide | ||||
Gene Ontology Terms (17)
Functions (2)
Components (14)
Processes (1)
Items per page:
10
1 – 2 of 2
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Traceable Author Statement (TAS) | Reactome | |||
Inferred from Electronic Annotation (IEA) | InterPro | |||
Protein-Protein Interactions (74)
1 – 10 of 74
CDK18
Family: Kinase
Novelty: 0.06025368
p_int: 0.953362943
p_ni: 0.046248258
p_wrong: 0.000388798
Score: 0.417
Data Source: BioPlex,STRINGDB
SLC4A4
Family: Transporter
Novelty: 0.00221797
Score: 0.824
Data Source: STRINGDB
CYP24A1
Family: Enzyme
Novelty: 0.00108437
Score: 0.739
Data Source: STRINGDB
TALDO1
Family: Enzyme
Novelty: 0.00254889
Score: 0.643
Data Source: STRINGDB
UHMK1
Family: Kinase
Novelty: 0.00180095
Score: 0.641
Data Source: STRINGDB
WTAP
Novelty: 0.04562162
Score: 0.633
Data Source: STRINGDB
PRSS12
Novelty: 0.03177005
Score: 0.632
Data Source: STRINGDB
VEGFA
Novelty: 0.00004909
Score: 0.632
Data Source: STRINGDB
RP9
Novelty: 0.01717654
Score: 0.57
Data Source: STRINGDB
SLC4A1
Family: Transporter
Novelty: 0.0017199
Score: 0.566
Data Source: STRINGDB
Publication Statistics
PubMed Score 1591.17
PubMed score by year
PubTator Score 569.44
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRF
1-70
FFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMH
70-140
IVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPK
140-210
EEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRT
210-280
VIKSGAPGRPLPWALPALLGPMLACLLAGFLR
280-312
MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLGPMLACLLAGFLR
Find similar targets by: