You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NR4A1
Nuclear receptor subfamily 4 group A member 1

Protein Summary
Description
Orphan nuclear receptor. May act concomitantly with NURR1 in regulating the expression of delayed-early genes during liver regeneration. Binds the NGFI-B response element (NBRE) 5'-AAAAGGTCA-3' (By similarity). May inhibit NF-kappa-B transactivation of IL2. Participates in energy homeostasis by sequestrating the kinase STK11 in the nucleus, thereby attenuating cytoplasmic AMPK activation. Plays a role in the vascular response to injury (By similarity). This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000243050
  • ENSP00000243050
  • ENSG00000123358
  • ENST00000360284
  • ENSP00000353427
  • ENST00000394824
  • ENSP00000378301
  • ENST00000394825
  • ENSP00000378302
  • ENST00000548232
  • ENSP00000449587
  • ENST00000550082
  • ENSP00000449539

Symbol
  • GFRP1
  • HMR
  • NAK1
  • HMR
  • N10
  • TR3
  • NP10
  • GFRP1
  • NAK-1
  • NGFIB
  • NUR77
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
1
protein domain
0.92
small molecule perturbation
0.9
biological term
0.87
kinase
0.87


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 890.09   (req: < 5)
Gene RIFs: 174   (req: <= 3)
Antibodies: 656   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 890.09   (req: >= 5)
Gene RIFs: 174   (req: > 3)
Antibodies: 656   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 23
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (15)
1 – 5 of 15
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (26)
AKT phosphorylates targets in the nucleus (R-HSA-198693)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
AKT phosphorylates targets in the nucleus
Reactome
Constitutive Signaling by AKT1 E17K in Cancer
Reactome
Disease
Reactome
Diseases of signal transduction
Reactome
Gene expression (Transcription)
Name
Explore in Pharos
Explore in Source
AKT phosphorylates targets in the nucleus
Constitutive Signaling by AKT1 E17K in Cancer
Disease
Diseases of signal transduction
Gene expression (Transcription)
Gene Ontology Terms (28)
Items per page:
10
1 – 10 of 11
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (172)
1 – 10 of 172
MIDN
Tbio
Novelty: 0.06131834
p_int: 0.999993743
p_ni: 0.000006254
p_wrong: 3e-9
Score: 0.38
Data Source: BioPlex,STRINGDB
ACAD11
Tbio
Family: Enzyme
Novelty: 0.55263158
p_int: 0.997953552
p_ni: 0.002046448
Score: 0.167
Data Source: BioPlex,STRINGDB
TMTC4
Tdark
Novelty: 0.8
p_int: 0.995380876
p_ni: 0.004619107
p_wrong: 1.8e-8
Score: 0.188
Data Source: BioPlex,STRINGDB
GRK6
Tchem
Family: Kinase
Novelty: 0.0342143
p_int: 0.763961156
p_ni: 0.235964274
p_wrong: 0.00007457
Score: 0.243
Data Source: BioPlex,STRINGDB
AKT1
Tchem
Family: Kinase
Novelty: 0.0000383
Score: 0.984
Data Source: Reactome,STRINGDB
MEF2D
Tbio
Family: TF
Novelty: 0.008552
Score: 0.968
Data Source: STRINGDB
BCL2
Tclin
Novelty: 0.00566111
Score: 0.958
Data Source: STRINGDB
EP300
Tchem
Family: Epigenetic
Novelty: 0.00060382
Score: 0.955
Data Source: STRINGDB
MAPK1
Tchem
Family: Kinase
Novelty: 0.00046573
Score: 0.951
Data Source: STRINGDB
RXRA
Tclin
Family: NR
Novelty: 0.00314166
Score: 0.95
Data Source: STRINGDB
Publication Statistics
PubMed Score  890.09

PubMed score by year
PubTator Score  2495.32

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQ
1-70
LPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPS
70-140
PSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLF
140-210
PSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYG
210-280
VRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLP
280-350
SKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKW
350-420
AEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFS
420-490
RSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLP
490-560
ELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
560-598
MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF