You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SLC2A5
Solute carrier family 2, facilitated glucose transporter member 5

Protein Summary
Description
Functions as a fructose transporter that has only low activity with other monosaccharides (PubMed:8333543). Can mediate the uptake of 2-deoxyglucose, but with low efficiency (PubMed:1695905). Essential for fructose uptake in the small intestine. Plays a role in the regulation of salt uptake and blood pressure in response to dietary fructose. Required for the development of high blood pressure in response to high dietary fructose intake (By similarity). The protein encoded by this gene is a fructose transporter responsible for fructose uptake by the small intestine. The encoded protein also is necessary for the increase in blood pressure due to high dietary fructose consumption. [provided by RefSeq, Jun 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000377414
  • ENSP00000366631
  • ENSG00000142583
  • ENST00000377424
  • ENSP00000366641

Symbol
  • GLUT5
  • GLUT5
  • GLUT-5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.88
cell type or tissue
0.74
protein domain
0.73
phenotype
0.67
small molecule perturbation
0.63


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 221.97   (req: < 5)
Gene RIFs: 21   (req: <= 3)
Antibodies: 365   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 221.97   (req: >= 5)
Gene RIFs: 21   (req: > 3)
Antibodies: 365   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (10)
Digestion and absorption (R-HSA-8963743)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Digestion and absorption
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Intestinal absorption
Reactome
Intestinal hexose absorption
Name
Explore in Pharos
Explore in Source
Digestion and absorption
Immune System
Innate Immune System
Intestinal absorption
Intestinal hexose absorption
Protein-Protein Interactions (151)
1 – 10 of 151
RBFOX3
Tbio
Novelty: 0.00055349
p_int: 0.989334196
p_ni: 0.010662114
p_wrong: 0.00000369
Score: 0.327
Data Source: BioPlex,STRINGDB
SLC7A3
Tbio
Family: Transporter
Novelty: 0.00610711
p_int: 0.980249567
p_ni: 0.018991367
p_wrong: 0.000759066
Score: 0.266
Data Source: BioPlex,STRINGDB
ATP12A
Tchem
Family: Transporter
Novelty: 0.00013675
p_int: 0.975421714
p_ni: 0.024578286
Score: 0.181
Data Source: BioPlex,STRINGDB
LMBRD2
Tdark
Novelty: 3
p_int: 0.961104983
p_ni: 0.038894988
p_wrong: 3e-8
Score: 0.184
Data Source: BioPlex,STRINGDB
ATP2B2
Tbio
Family: Transporter
Novelty: 0.00724828
p_int: 0.938379378
p_ni: 0.061620622
Score: 0.273
Data Source: BioPlex,STRINGDB
ZMPSTE24
Tbio
Family: Enzyme
Novelty: 0.00353005
p_int: 0.897896928
p_ni: 0.102067299
p_wrong: 0.000035773
Score: 0.228
Data Source: BioPlex,STRINGDB
FITM2
Tdark
Novelty: 0.02272483
p_int: 0.802957205
p_ni: 0.069884125
p_wrong: 0.127158669
Data Source: BioPlex
OSBPL6
Tbio
Novelty: 0.27710301
p_int: 0.797121528
p_ni: 0.202663043
p_wrong: 0.000215429
Score: 0.173
Data Source: BioPlex,STRINGDB
ECPAS
Tbio
Novelty: 0.05663049
p_int: 0.780188107
p_ni: 0.219811893
p_wrong: 1e-9
Score: 0.194
Data Source: BioPlex,STRINGDB
UBR4
Tbio
Family: Enzyme
Novelty: 0.05991158
Score: 0.919
Data Source: STRINGDB
Publication Statistics
PubMed Score  221.97

PubMed score by year
PubTator Score  126.43

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGEFMEDFPLTLL
1-70
WSVTVSMFPFGGFIGSLLVGPLVNKFGRKGALLFNNIFSIVPAILMGCSRVATSFELIIISRLLVGICAG
70-140
VSSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQIFGLRNLLANVDGWPILLGLTGVPAALQLLLL
140-210
PFFPESPRYLLIQKKDEAAAKKALQTLRGWDSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQLLS
210-280
IIVLMGGQQLSGVNAIYYYADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGFS
280-350
ICLIACCVLTAALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLITEIFLQSSRPSAFMVGGSVHW
350-420
LSNFTVGLIFPFIQEGLGPYSFIVFAVICLLTTIYIFLIVPETKAKTFIEINQIFTKMNKVSEVYPEKEE
420-490
LKELPPVTSEQ
490-501
MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGEFMEDFPLTLLWSVTVSMFPFGGFIGSLLVGPLVNKFGRKGALLFNNIFSIVPAILMGCSRVATSFELIIISRLLVGICAGVSSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQIFGLRNLLANVDGWPILLGLTGVPAALQLLLLPFFPESPRYLLIQKKDEAAAKKALQTLRGWDSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQLLSIIVLMGGQQLSGVNAIYYYADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGFSICLIACCVLTAALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLITEIFLQSSRPSAFMVGGSVHWLSNFTVGLIFPFIQEGLGPYSFIVFAVICLLTTIYIFLIVPETKAKTFIEINQIFTKMNKVSEVYPEKEELKELPPVTSEQ