You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NME2
Nucleoside diphosphate kinase B

Protein Summary
Description
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity). Negatively regulates Rho activity by interacting with AKAP13/LBC (PubMed:15249197). Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically (PubMed:8392752, PubMed:19435876). Binds to both single-stranded guanine- and cytosine-rich strands within the nuclease hypersensitive element (NHE) III(1) region of the MYC gene promoter. Does not bind to duplex NHE III(1) (PubMed:19435876). Has G-quadruplex (G4) DNA-binding activity, which is independent of its nucleotide-binding and kinase activity. Binds both folded and unfolded G4 with similar low nanomolar affinities. Stabilizes folded G4s regardless of whether they are prefolded or not (PubMed:25679041). Exhibits histidine protein kinase activity (PubMed:20946858). Nucleoside diphosphate kinas ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000393190
  • ENSP00000376886
  • ENSG00000243678
  • ENST00000503064
  • ENSP00000426901
  • ENST00000512737
  • ENSP00000421064
  • ENST00000513177
  • ENSP00000425581
  • ENST00000514264
  • ENSP00000426976

Symbol
  • NM23B
  • PUF
  • NDKB
  • NDPKB
  • NM23B
  • NDPK-B
  • NM23-H2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.72
histone modification site profile
0.71
small molecule perturbation
0.71
cellular component
0.63
disease
0.63


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 720.24   (req: < 5)
Gene RIFs: 41   (req: <= 3)
Antibodies: 90   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 720.24   (req: >= 5)
Gene RIFs: 41   (req: > 3)
Antibodies: 90   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 37
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (32)
Immune System (R-HSA-168256)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Interconversion of nucleotide di- and triphosphates
Reactome
Metabolism
Reactome
Metabolism of nucleotides
Name
Explore in Pharos
Explore in Source
Immune System
Innate Immune System
Interconversion of nucleotide di- and triphosphates
Metabolism
Metabolism of nucleotides
Gene Ontology Terms (51)
Items per page:
10
1 – 10 of 12
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (327)
1 – 10 of 327
NME3
Tbio
Family: Kinase
Novelty: 0.01659326
p_int: 0.999999986
p_ni: 1e-8
p_wrong: 4e-9
Score: 0.875
Data Source: BioPlex,STRINGDB
WWOX
Tbio
Family: Enzyme
Novelty: 0.0030135
p_int: 0.999945528
p_ni: 0.000054472
Data Source: BioPlex
SMOC1
Tbio
Novelty: 0.05266597
p_int: 0.999204369
p_ni: 0.000795629
p_wrong: 2e-9
Data Source: BioPlex
TRABD
Tdark
Novelty: 0.88888889
p_int: 0.999099244
p_ni: 0.000898499
p_wrong: 0.000002257
Data Source: BioPlex
NPC2
Tbio
Novelty: 0.00487879
p_int: 0.99908358
p_ni: 0.00091642
Data Source: BioPlex
FGB
Tbio
Novelty: 0.00757235
p_int: 0.998859069
p_ni: 0.001140911
p_wrong: 2e-8
Data Source: BioPlex
SLC48A1
Tbio
Family: Transporter
Novelty: 0.4196446
p_int: 0.998767539
p_ni: 0.001230927
p_wrong: 0.000001534
Data Source: BioPlex
CCNG2
Tbio
Novelty: 0.01899958
p_int: 0.998247171
p_ni: 0.001741742
p_wrong: 0.000011086
Score: 0.188
Data Source: BioPlex,STRINGDB
FAM24B
Tdark
p_int: 0.997980188
p_ni: 0.001049428
p_wrong: 0.000970384
Data Source: BioPlex
APP
Tchem
Novelty: 0.00011446
p_int: 0.996563927
p_ni: 0.003436073
Data Source: BioPlex
Publication Statistics
PubMed Score  720.24

PubMed score by year
PubTator Score  598.79

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNS
1-70
GPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELV
70-140
DYKSCAHDWVYE
140-152
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE