You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MUT
Methylmalonyl-CoA mutase, mitochondrial

Protein Classes
Protein Summary
Description
Involved in the degradation of several amino acids, odd-chain fatty acids and cholesterol via propionyl-CoA to the tricarboxylic acid cycle. MCM has different functions in other species. This gene encodes the mitochondrial enzyme methylmalonyl Coenzyme A mutase. In humans, the product of this gene is a vitamin B12-dependent enzyme which catalyzes the isomerization of methylmalonyl-CoA to succinyl-CoA, while in other species this enzyme may have different functions. Mutations in this gene may lead to various types of methylmalonic aciduria. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000274813
  • ENSP00000274813
  • ENSG00000146085

Symbol
  • MCM
  • MUT
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.98
disease perturbation
0.93
histone modification site profile
0.87
protein domain
0.85
virus perturbation
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 324.91   (req: < 5)
Gene RIFs: 34   (req: <= 3)
Antibodies: 152   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 324.91   (req: >= 5)
Gene RIFs: 34   (req: > 3)
Antibodies: 152   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (16)
Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
KEGG
Propanoate metabolism
KEGG
Carbon metabolism
KEGG
Metabolic pathways
KEGG
Valine, leucine and isoleucine degradation
KEGG
Glyoxylate and dicarboxylate metabolism
Name
Explore in Pharos
Explore in Source
Propanoate metabolism
Carbon metabolism
Metabolic pathways
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Gene Ontology Terms (13)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (88)
1 – 10 of 88
TMEM184A
Tbio
Novelty: 0.18808777
p_int: 0.973183686
p_ni: 0.026816314
Score: 0.188
Data Source: BioPlex,STRINGDB
CFH
Tbio
Novelty: 0.0006078
p_int: 0.968147111
p_ni: 0.031852889
Score: 0.623
Data Source: BioPlex,STRINGDB
GRPEL2
Tdark
Novelty: 0.77922078
p_int: 0.951827959
p_ni: 0.048172041
Score: 0.687
Data Source: BioPlex,STRINGDB
CRYZ
Tbio
Family: Enzyme
Novelty: 0.0019263
p_int: 0.944545592
p_ni: 0.055454408
Score: 0.198
Data Source: BioPlex,STRINGDB
MMAA
Tbio
Novelty: 0.00536256
Score: 0.998
Data Source: Reactome,STRINGDB
MCEE
Tbio
Family: Enzyme
Novelty: 0.07926976
Score: 0.992
Data Source: STRINGDB
MMAB
Tbio
Family: Enzyme
Novelty: 0.01573568
Score: 0.958
Data Source: STRINGDB
SUCLG1
Tbio
Family: Enzyme
Novelty: 0.00921792
Score: 0.948
Data Source: STRINGDB
SUCLA2
Tbio
Family: Enzyme
Novelty: 0.00174533
Score: 0.936
Data Source: STRINGDB
ACSF3
Tbio
Family: Enzyme
Novelty: 0.06563681
Score: 0.932
Data Source: STRINGDB
Publication Statistics
PubMed Score  324.91

PubMed score by year
PubTator Score  418.88

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLRAKNQLFLLSPHYLRQVKESSGSRLIQQRLLHQQQPLHPEWAALAKKQLKGKNPEDLIWHTPEGISIK
1-70
PLYSKRDTMDLPEELPGVKPFTRGPYPTMYTFRPWTIRQYAGFSTVEESNKFYKDNIKAGQQGLSVAFDL
70-140
ATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILFDGIPLEKMSVSMTMNGAVIPVLANFIVTGEEQGVPK
140-210
EKLTGTIQNDILKEFMVRNTYIFPPEPSMKIIADIFEYTAKHMPKFNSISISGYHMQEAGADAILELAYT
210-280
LADGLEYSRTGLQAGLTIDEFAPRLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLLRAH
280-350
CQTSGWSLTEQDPYNNIVRTAIEAMAAVFGGTQSLHTNSFDEALGLPTVKSARIARNTQIIIQEESGIPK
350-420
VADPWGGSYMMECLTNDVYDAALKLINEIEEMGGMAKAVAEGIPKLRIEECAARRQARIDSGSEVIVGVN
420-490
KYQLEKEDAVEVLAIDNTSVRNRQIEKLKKIKSSRDQALAERCLAALTECAASGDGNILALAVDASRARC
490-560
TVGEITDALKKVFGEHKANDRMVSGAYRQEFGESKEITSAIKRVHKFMEREGRRPRLLVAKMGQDGHDRG
560-630
AKVIATGFADLGFDVDIGPLFQTPREVAQQAVDADVHAVGISTLAAGHKTLVPELIKELNSLGRPDILVM
630-700
CGGVIPPQDYEFLFEVGVSNVFGPGTRIPKAAVQVLDDIEKCLEKKQQSV
700-750
MLRAKNQLFLLSPHYLRQVKESSGSRLIQQRLLHQQQPLHPEWAALAKKQLKGKNPEDLIWHTPEGISIKPLYSKRDTMDLPEELPGVKPFTRGPYPTMYTFRPWTIRQYAGFSTVEESNKFYKDNIKAGQQGLSVAFDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILFDGIPLEKMSVSMTMNGAVIPVLANFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYIFPPEPSMKIIADIFEYTAKHMPKFNSISISGYHMQEAGADAILELAYTLADGLEYSRTGLQAGLTIDEFAPRLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLLRAHCQTSGWSLTEQDPYNNIVRTAIEAMAAVFGGTQSLHTNSFDEALGLPTVKSARIARNTQIIIQEESGIPKVADPWGGSYMMECLTNDVYDAALKLINEIEEMGGMAKAVAEGIPKLRIEECAARRQARIDSGSEVIVGVNKYQLEKEDAVEVLAIDNTSVRNRQIEKLKKIKSSRDQALAERCLAALTECAASGDGNILALAVDASRARCTVGEITDALKKVFGEHKANDRMVSGAYRQEFGESKEITSAIKRVHKFMEREGRRPRLLVAKMGQDGHDRGAKVIATGFADLGFDVDIGPLFQTPREVAQQAVDADVHAVGISTLAAGHKTLVPELIKELNSLGRPDILVMCGGVIPPQDYEFLFEVGVSNVFGPGTRIPKAAVQVLDDIEKCLEKKQQSV