You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
ERBB3
Receptor tyrosine-protein kinase erbB-3

Protein Summary
Description
Tyrosine-protein kinase that plays an essential role as cell surface receptor for neuregulins. Binds to neuregulin-1 (NRG1) and is activated by it; ligand-binding increases phosphorylation on tyrosine residues and promotes its association with the p85 subunit of phosphatidylinositol 3-kinase (PubMed:20682778). May also be activated by CSPG5 (PubMed:15358134). This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000267101
  • ENSP00000267101
  • ENSG00000065361
  • ENST00000411731
  • ENSP00000415753
  • ENST00000415288
  • ENSP00000408340
  • ENST00000551242
  • ENSP00000447510

Symbol
  • HER3
  • HER3
  • FERLK
  • LCCS2
  • ErbB-3
  • c-erbB3
  • erbB3-S
  • MDA-BF-1
  • c-erbB-3
  • p180-ErbB3
  • p45-sErbB3
  • p85-sErbB3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
protein domain
0.99
transcription factor perturbation
0.98
hub protein
0.97
kinase perturbation
0.95


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 961.8   (req: < 5)
Gene RIFs: 342   (req: <= 3)
Antibodies: 2081   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 961.8   (req: >= 5)
Gene RIFs: 342   (req: > 3)
Antibodies: 2081   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 42
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 3
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 4
Protein Data Bank (14)
1 – 5 of 14
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (66)
Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 29
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Constitutive Signaling by Aberrant PI3K in Cancer
Reactome
Cytokine Signaling in Immune system
Reactome
Disease
Reactome
Diseases of signal transduction
Reactome
Downregulation of ERBB2 signaling
Name
Explore in Pharos
Explore in Source
Constitutive Signaling by Aberrant PI3K in Cancer
Cytokine Signaling in Immune system
Disease
Diseases of signal transduction
Downregulation of ERBB2 signaling
Gene Ontology Terms (51)
Items per page:
10
1 – 10 of 14
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (258)
1 – 10 of 258
HLA-A
Tbio
Novelty: 0.00378961
p_int: 0.965650226
p_ni: 0.034349773
Score: 0.367
Data Source: BioPlex,STRINGDB
UQCRH
Tbio
Novelty: 0.06154741
p_int: 0.939955803
p_ni: 0.002908501
p_wrong: 0.057135696
Score: 0.173
Data Source: BioPlex,STRINGDB
SLC31A1
Tbio
Family: Transporter
Novelty: 0.00796442
p_int: 0.932496876
p_ni: 0.067502664
p_wrong: 4.6e-7
Score: 0.234
Data Source: BioPlex,STRINGDB
TUBA4A
Tchem
Novelty: 0.02626744
p_int: 0.924464822
p_ni: 0.075535178
Data Source: BioPlex
HLA-DPA1
Tbio
Novelty: 0.01432663
p_int: 0.900799999
p_ni: 0.072877564
p_wrong: 0.026322437
Data Source: BioPlex
PDF
Tchem
Family: Enzyme
Novelty: 0.02731986
p_int: 0.793658535
p_ni: 0.206341465
p_wrong: 1e-9
Score: 0.177
Data Source: BioPlex,STRINGDB
TUBB8
Tclin
Novelty: 0.11569363
p_int: 0.764674375
p_ni: 0.235325625
Data Source: BioPlex
NRG1
Tbio
Novelty: 0.00114197
Score: 0.997
Data Source: Reactome,STRINGDB
GRB2
Tchem
Novelty: 0.00060543
Score: 0.994
Data Source: Reactome,STRINGDB
NRG2
Tbio
Novelty: 0.02957789
Score: 0.993
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  961.80

PubMed score by year
PubTator Score  864.45

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGH
1-70
NADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLT
70-140
EILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTIC
140-210
APQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKY
210-280
QYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDG
280-350
FVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
350-420
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPR
420-490
RDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPME
490-560
GTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCL
560-630
GQTLVLIGKTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVL
630-700
ARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAH
700-770
IVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
770-840
LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAE
840-910
PYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIKR
910-980
ESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEEDNLATTTLGSALSLPVGTLNRPRGSQSLLSP
980-1050
SSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSR
1050-1120
SRSPRPRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEE
1120-1190
EDEDEEYEYMNRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDY
1190-1260
EYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWH
1260-1330
SRLFPKANAQRT
1330-1342
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEEDNLATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSRSRSPRPRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYMNRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDYEYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWHSRLFPKANAQRT