You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
KITLG
Kit ligand

Protein Summary
Description
Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins. This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000228280
  • ENSP00000228280
  • ENSG00000049130
  • ENST00000347404
  • ENSP00000054216
  • ENST00000644744
  • ENSP00000495951

Symbol
  • MGF
  • SCF
  • SF
  • MGF
  • SCF
  • SLF
  • DCUA
  • FPH2
  • FPHH
  • KL-1
  • Kitl
  • SHEP7
  • DFNA69
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
1
biological process
0.97
biological term
0.97
gene perturbation
0.91
PubMedID
0.82


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1922.18   (req: < 5)
Gene RIFs: 171   (req: <= 3)
Antibodies: 828   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1922.18   (req: >= 5)
Gene RIFs: 171   (req: > 3)
Antibodies: 828   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 26
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (91)
Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 20
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Constitutive Signaling by Aberrant PI3K in Cancer
Reactome
Cytokine Signaling in Immune system
Reactome
Disease
Reactome
Diseases of signal transduction
Reactome
FLT3 Signaling
Name
Explore in Pharos
Explore in Source
Constitutive Signaling by Aberrant PI3K in Cancer
Cytokine Signaling in Immune system
Disease
Diseases of signal transduction
FLT3 Signaling
Gene Ontology Terms (34)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (302)
1 – 10 of 302
KLHDC10
Tdark
Novelty: 0.60606061
p_int: 0.999962722
p_ni: 0.00003727
p_wrong: 8e-9
Score: 0.455
Data Source: BioPlex,STRINGDB
ATP8B2
Tdark
Family: Transporter
Novelty: 0.20856013
p_int: 0.985642839
p_ni: 0.014357161
Score: 0.534
Data Source: BioPlex,STRINGDB
SLC22A18
Tbio
Family: Transporter
Novelty: 0.00369458
p_int: 0.864467356
p_ni: 0.135388639
p_wrong: 0.000144005
Score: 0.2
Data Source: BioPlex,STRINGDB
KIT
Tclin
Family: Kinase
Novelty: 0.00013951
Score: 0.999
Data Source: Reactome,STRINGDB
EPO
Tbio
Novelty: 0.00017234
Score: 0.984
Data Source: STRINGDB
EPOR
Tclin
Novelty: 0.00150259
Score: 0.97
Data Source: STRINGDB
PDGFRB
Tclin
Family: Kinase
Novelty: 0.00115144
Score: 0.967
Data Source: STRINGDB
STAT3
Tchem
Family: TF
Novelty: 0.00013496
Score: 0.966
Data Source: Reactome,STRINGDB
MATK
Tbio
Family: Kinase
Novelty: 0.00103714
Score: 0.957
Data Source: STRINGDB
FLT3
Tclin
Family: Kinase
Novelty: 0.00045788
Score: 0.948
Data Source: STRINGDB
Publication Statistics
PubMed Score  1922.18

PubMed score by year
PubTator Score  2278.54

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWI
1-70
SEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEF
70-140
FRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGD
140-210
SSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV
210-273
MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV