You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CNR1
Cannabinoid receptor 1

Protein Summary
Description
G-protein coupled receptor for endogenous cannabinoids (eCBs), including N-arachidonoylethanolamide (also called anandamide or AEA) and 2-arachidonoylglycerol (2-AG), as well as phytocannabinoids, such as delta(9)-tetrahydrocannabinol (THC) (PubMed:15620723, PubMed:27768894, PubMed:27851727). Mediates many cannabinoid-induced effects, acting, among others, on food intake, memory loss, gastrointestinal motility, catalepsy, ambulatory activity, anxiety, chronic pain. Signaling typically involves reduction in cyclic AMP (PubMed:1718258, PubMed:21895628, PubMed:27768894). In the hypothalamus, may have a dual effect on mitochondrial respiration depending upon the agonist dose and possibly upon the cell type. Increases respiration at low doses, while decreases respiration at high doses. At high doses, CNR1 signal transduction involves G-protein alpha-i protein activation and subsequent inhibition of mitochondrial soluble adenylate cyclase, decrease in cyclic AMP concentration, inhibition of ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369499
  • ENSP00000358511
  • ENSG00000118432
  • ENST00000369501
  • ENSP00000358513
  • ENST00000428600
  • ENSP00000412192
  • ENST00000468898
  • ENSP00000420188
  • ENST00000549890
  • ENSP00000446819

Symbol
  • CNR
  • CB1
  • CNR
  • CB-R
  • CB1A
  • CB1R
  • CANN6
  • CB1K5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.99
phenotype
0.99
chemical
0.88
microRNA
0.84
disease
0.82


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5740.15   (req: < 5)
Gene RIFs: 380   (req: <= 3)
Antibodies: 546   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5740.15   (req: >= 5)
Gene RIFs: 380   (req: > 3)
Antibodies: 546   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 38
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 1668
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 4
Protein Data Bank (11)
1 – 5 of 11
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (20)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Signal Transduction
Protein-Protein Interactions (378)
1 – 10 of 378
GPR55
Tclin
Family: GPCR
Novelty: 0.00622506
Score: 0.989
Data Source: STRINGDB
OPRL1
Tchem
Family: GPCR
Novelty: 0.00075372
Score: 0.984
Data Source: STRINGDB
DRD2
Tclin
Family: GPCR
Novelty: 0.00028344
Score: 0.984
Data Source: STRINGDB
OPRD1
Tclin
Family: GPCR
Novelty: 0.001182
Score: 0.983
Data Source: STRINGDB
GPR18
Tchem
Family: GPCR
Novelty: 0.02758408
Score: 0.969
Data Source: STRINGDB
DRD3
Tclin
Family: GPCR
Novelty: 0.00058433
Score: 0.966
Data Source: STRINGDB
DRD4
Tchem
Family: GPCR
Novelty: 0.00047256
Score: 0.965
Data Source: STRINGDB
ADRA2A
Tclin
Family: GPCR
Novelty: 0.00092475
Score: 0.962
Data Source: STRINGDB
NPY
Tbio
Novelty: 0.00014761
Score: 0.961
Data Source: STRINGDB
ADRA2C
Tclin
Family: GPCR
Novelty: 0.00110399
Score: 0.961
Data Source: STRINGDB
Publication Statistics
PubMed Score  5740.15

PubMed score by year
PubTator Score  2145.35

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQL
1-70
VPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCV
70-140
ILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLT
140-210
AIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWI
210-280
GVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILV
280-350
VLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ
350-420
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
420-472
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL