You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MX2
Interferon-induced GTP-binding protein Mx2

Protein Summary
Description
Interferon-induced dynamin-like GTPase with potent antiviral activity against human immunodeficiency virus type 1 (HIV-1). Acts by targeting the viral capsid and affects the nuclear uptake and/or stability of the HIV-1 replication complex and the subsequent chromosomal integration of the proviral DNA. Exhibits antiviral activity also against simian immunodeficiency virus (SIV-mnd). May play a role in regulating nucleocytoplasmic transport and cell-cycle progression. The protein encoded by this gene has a nuclear and a cytoplasmic form and is a member of both the dynamin family and the family of large GTPases. The nuclear form is localized in a granular pattern in the heterochromatin region beneath the nuclear envelope. A nuclear localization signal (NLS) is present at the amino terminal end of the nuclear form but is lacking in the cytoplasmic form due to use of an alternate translation start codon. This protein is upregulated by interferon-alpha but does not contain the antiviral acti ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000330714
  • ENSP00000333657
  • ENSG00000183486

Symbol
  • MXB
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
1
protein domain
0.97
molecular function
0.91
PubMedID
0.82
cellular component
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 458.31   (req: < 5)
Gene RIFs: 32   (req: <= 3)
Antibodies: 119   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 458.31   (req: >= 5)
Gene RIFs: 32   (req: > 3)
Antibodies: 119   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (27)
Antiviral mechanism by IFN-stimulated genes (R-HSA-1169410)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Antiviral mechanism by IFN-stimulated genes
Reactome
Cytokine Signaling in Immune system
Reactome
ISG15 antiviral mechanism
Reactome
Immune System
Reactome
Interferon Signaling
Name
Explore in Pharos
Explore in Source
Antiviral mechanism by IFN-stimulated genes
Cytokine Signaling in Immune system
ISG15 antiviral mechanism
Immune System
Interferon Signaling
Gene Ontology Terms (22)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (208)
1 – 10 of 208
OASL
Tbio
Family: Enzyme
Novelty: 0.02020019
Score: 0.997
Data Source: STRINGDB
IFIT1
Tbio
Novelty: 0.00862855
Score: 0.994
Data Source: STRINGDB
RSAD2
Tbio
Novelty: 0.00786985
Score: 0.993
Data Source: STRINGDB
OAS2
Tbio
Family: Enzyme
Novelty: 0.03283444
Score: 0.991
Data Source: STRINGDB
ISG15
Tbio
Novelty: 0.00256125
Score: 0.991
Data Source: STRINGDB
IRF7
Tbio
Family: TF
Novelty: 0.00308898
Score: 0.991
Data Source: STRINGDB
OAS1
Tbio
Family: Enzyme
Novelty: 0.00774033
Score: 0.989
Data Source: STRINGDB
IFIT3
Tbio
Novelty: 0.00899003
Score: 0.988
Data Source: STRINGDB
OAS3
Tbio
Family: Enzyme
Novelty: 0.04260345
Score: 0.988
Data Source: STRINGDB
USP18
Tbio
Family: Enzyme
Novelty: 0.01398634
Score: 0.985
Data Source: STRINGDB
Publication Statistics
PubMed Score  458.31

PubMed score by year
PubTator Score  227.72

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSKAHKPWPYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNN
1-70
QPPPGNRSQPRAMGPENNLYSQYEQKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSG
70-140
VALPRGSGIVTRCPLVLKLKKQPCEAWAGRISYRNTELELQDPGQVEKEIHKAQNVMAGNGRGISHELIS
140-210
LEITSPEVPDLTIIDLPGITRVAVDNQPRDIGLQIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAH
210-280
EVDPEGDRTIGILTKPDLMDRGTEKSVMNVVRNLTYPLKKGYMIVKCRGQQEITNRLSLAEATKKEITFF
280-350
QTHPYFRVLLEEGSATVPRLAERLTTELIMHIQKSLPLLEGQIRESHQKATEELRRCGADIPSQEADKMF
350-420
FLIEKIKMFNQDIEKLVEGEEVVRENETRLYNKIREDFKNWVGILATNTQKVKNIIHEEVEKYEKQYRGK
420-490
ELLGFVNYKTFEIIVHQYIQQLVEPALSMLQKAMEIIQQAFINVAKKHFGEFFNLNQTVQSTIEDIKVKH
490-560
TAKAENMIQLQFRMEQMVFCQDQIYSVVLKKVREEIFNPLGTPSQNMKLNSHFPSNESSVSSFTEIGIHL
560-630
NAYFLETSKRLANQIPFIIQYFMLRENGDSLQKAMMQILQEKNRYSWLLQEQSETATKRRILKERIYRLT
630-700
QARHALCQFSSKEIH
700-715
MSKAHKPWPYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMGPENNLYSQYEQKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKQPCEAWAGRISYRNTELELQDPGQVEKEIHKAQNVMAGNGRGISHELISLEITSPEVPDLTIIDLPGITRVAVDNQPRDIGLQIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAHEVDPEGDRTIGILTKPDLMDRGTEKSVMNVVRNLTYPLKKGYMIVKCRGQQEITNRLSLAEATKKEITFFQTHPYFRVLLEEGSATVPRLAERLTTELIMHIQKSLPLLEGQIRESHQKATEELRRCGADIPSQEADKMFFLIEKIKMFNQDIEKLVEGEEVVRENETRLYNKIREDFKNWVGILATNTQKVKNIIHEEVEKYEKQYRGKELLGFVNYKTFEIIVHQYIQQLVEPALSMLQKAMEIIQQAFINVAKKHFGEFFNLNQTVQSTIEDIKVKHTAKAENMIQLQFRMEQMVFCQDQIYSVVLKKVREEIFNPLGTPSQNMKLNSHFPSNESSVSSFTEIGIHLNAYFLETSKRLANQIPFIIQYFMLRENGDSLQKAMMQILQEKNRYSWLLQEQSETATKRRILKERIYRLTQARHALCQFSSKEIH