You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MX1
Interferon-induced GTP-binding protein Mx1

Protein Summary
Description
Interferon-induced dynamin-like GTPase with antiviral activity against a wide range of RNA viruses and some DNA viruses. Its target viruses include negative-stranded RNA viruses and HBV through binding and inactivation of their ribonucleocapsid. May also antagonize reoviridae and asfarviridae replication. Inhibits thogoto virus (THOV) replication by preventing the nuclear import of viral nucleocapsids. Inhibits La Crosse virus (LACV) replication by sequestering viral nucleoprotein in perinuclear complexes, preventing genome amplification, budding, and egress. Inhibits influenza A virus (IAV) replication by decreasing or delaying NP synthesis and by blocking endocytic traffic of incoming virus particles. Enhances ER stress-mediated cell death after influenza virus infection. May regulate the calcium channel activity of TRPCs. This gene encodes a guanosine triphosphate (GTP)-metabolizing protein that participates in the cellular antiviral response. The encoded protein is induced by type ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000398598
  • ENSP00000381599
  • ENSG00000157601
  • ENST00000398600
  • ENSP00000381601
  • ENST00000455164
  • ENSP00000410523
  • ENST00000619682
  • ENSP00000478441

Symbol
  • MX
  • MxA
  • IFI78
  • IFI-78K
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
1
protein domain
0.97
molecular function
0.91
biological term
0.86
small molecule perturbation
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1187.61   (req: < 5)
Gene RIFs: 131   (req: <= 3)
Antibodies: 454   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1187.61   (req: >= 5)
Gene RIFs: 131   (req: > 3)
Antibodies: 454   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (7)
1 – 5 of 7
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (13)
Antiviral mechanism by IFN-stimulated genes (R-HSA-1169410)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Antiviral mechanism by IFN-stimulated genes
Reactome
Cytokine Signaling in Immune system
Reactome
ISG15 antiviral mechanism
Reactome
Immune System
Reactome
Interferon Signaling
Name
Explore in Pharos
Explore in Source
Antiviral mechanism by IFN-stimulated genes
Cytokine Signaling in Immune system
ISG15 antiviral mechanism
Immune System
Interferon Signaling
Gene Ontology Terms (24)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (283)
1 – 10 of 283
BCS1L
Tbio
Family: Enzyme
Novelty: 0.00258512
p_int: 0.97647566
p_ni: 0.023167253
p_wrong: 0.000357087
Score: 0.452
Data Source: BioPlex,STRINGDB
OASL
Tbio
Family: Enzyme
Novelty: 0.02020019
Score: 0.999
Data Source: STRINGDB
ISG15
Tbio
Novelty: 0.00256125
Score: 0.998
Data Source: STRINGDB
IFIT1
Tbio
Novelty: 0.00862855
Score: 0.998
Data Source: STRINGDB
OAS1
Tbio
Family: Enzyme
Novelty: 0.00774033
Score: 0.997
Data Source: STRINGDB
RSAD2
Tbio
Novelty: 0.00786985
Score: 0.997
Data Source: STRINGDB
STAT1
Tchem
Family: TF
Novelty: 0.00041067
Score: 0.996
Data Source: STRINGDB
OAS2
Tbio
Family: Enzyme
Novelty: 0.03283444
Score: 0.995
Data Source: STRINGDB
IRF7
Tbio
Family: TF
Novelty: 0.00308898
Score: 0.995
Data Source: STRINGDB
USP18
Tbio
Family: Enzyme
Novelty: 0.01398634
Score: 0.994
Data Source: STRINGDB
Publication Statistics
PubMed Score  1187.61

PubMed score by year
PubTator Score  645.41

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLRALGVEQDLAL
1-70
PAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVE
70-140
KEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQE
140-210
TISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKC
210-280
RGQQEIQDQLSLSEALQREKIFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETH
280-350
QRITEELQKYGVDIPEDENEKMFFLIDKVNAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIEN
350-420
NFQEGHKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMVRLAFTDVSIK
420-490
NFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWD
490-560
FGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLL
560-630
KERSDTSDKRKFLKERLARLTQARRRLAQFPG
630-662
MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREKIFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETHQRITEELQKYGVDIPEDENEKMFFLIDKVNAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIENNFQEGHKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMVRLAFTDVSIKNFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWDFGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPG