You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MSH3
DNA mismatch repair protein Msh3

Protein Summary
Description
Component of the post-replicative DNA mismatch repair system (MMR). Heterodimerizes with MSH2 to form MutS beta which binds to DNA mismatches thereby initiating DNA repair. When bound, the MutS beta heterodimer bends the DNA helix and shields approximately 20 base pairs. MutS beta recognizes large insertion-deletion loops (IDL) up to 13 nucleotides long. After mismatch binding, forms a ternary complex with the MutL alpha heterodimer, which is thought to be responsible for directing the downstream MMR events, including strand discrimination, excision, and resynthesis. The protein encoded by this gene forms a heterodimer with MSH2 to form MutS beta, part of the post-replicative DNA mismatch repair system. MutS beta initiates mismatch repair by binding to a mismatch and then forming a complex with MutL alpha heterodimer. This gene contains a polymorphic 9 bp tandem repeat sequence in the first exon. The repeat is present 6 times in the reference genome sequence and 3-7 repeats have been r ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000265081
  • ENSP00000265081
  • ENSG00000113318

Symbol
  • DUC1
  • DUG
  • DUP
  • FAP4
  • MRP1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
1
molecular function
1
kinase perturbation
0.93
protein domain
0.92
histone modification site profile
0.88


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 305.41   (req: < 5)
Gene RIFs: 55   (req: <= 3)
Antibodies: 259   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 305.41   (req: >= 5)
Gene RIFs: 55   (req: > 3)
Antibodies: 259   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 17
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (33)
DNA Repair (R-HSA-73894)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
DNA Repair
Reactome
Defective Mismatch Repair Associated With MSH2
Reactome
Defective Mismatch Repair Associated With MSH3
Reactome
Disease
Reactome
Diseases of Mismatch Repair (MMR)
Name
Explore in Pharos
Explore in Source
DNA Repair
Defective Mismatch Repair Associated With MSH2
Defective Mismatch Repair Associated With MSH3
Disease
Diseases of Mismatch Repair (MMR)
Gene Ontology Terms (22)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (170)
1 – 10 of 170
APLF
Tbio
Novelty: 0.01671154
p_int: 0.997383973
p_ni: 0.000005555
p_wrong: 0.002610472
Score: 0.215
Data Source: BioPlex,STRINGDB
LMO2
Tbio
Novelty: 0.00508219
p_int: 0.996975043
p_ni: 0.000010338
p_wrong: 0.003014619
Score: 0.371
Data Source: BioPlex,STRINGDB
SLC39A9
Tbio
Family: Transporter
Novelty: 0.0825498
p_int: 0.910041304
p_ni: 0.000057556
p_wrong: 0.08990114
Score: 0.179
Data Source: BioPlex,STRINGDB
MLH1
Tbio
Novelty: 0.00040798
Score: 0.999
Data Source: Reactome,STRINGDB
MSH2
Tbio
Novelty: 0.00062722
Score: 0.999
Data Source: Reactome,STRINGDB
PMS2
Tbio
Family: Enzyme
Novelty: 0.00235398
Score: 0.998
Data Source: Reactome,STRINGDB
EXO1
Tbio
Family: Enzyme
Novelty: 0.0019799
Score: 0.995
Data Source: Reactome,STRINGDB
SNX8
Tbio
Novelty: 0.04101729
Score: 0.993
Data Source: STRINGDB
MSH6
Tbio
Family: Epigenetic
Novelty: 0.00148002
Score: 0.992
Data Source: STRINGDB
PCNA
Tchem
Novelty: 0.00995674
Score: 0.991
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  305.41

PubMed score by year
PubTator Score  167.06

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSRRKPASGGLAASSSAPARQAVLSRFFQSTGSLKSTSSSTGAADQVDPGAAAAAAAAAAAAPPAPPAPA
1-70
FPPQLPPHIATEIDRRKKRPLENDGPVKKKVKKVQQKEGGSDLGMSGNSEPKKCLRTRNVSKSLEKLKEF
70-140
CCDSALPQSRVQTESLQERFAVLPKCTDFDDISLLHAKNAVSSEDSKRQINQKDTTLFDLSQFGSSNTSH
140-210
ENLQKTASKSANKRSKSIYTPLELQYIEMKQQHKDAVLCVECGYKYRFFGEDAEIAARELNIYCHLDHNF
210-280
MTASIPTHRLFVHVRRLVAKGYKVGVVKQTETAALKAIGDNRSSLFSRKLTALYTKSTLIGEDVNPLIKL
280-350
DDAVNVDEIMTDTSTSYLLCISENKENVRDKKKGNIFIGIVGVQPATGEVVFDSFQDSASRSELETRMSS
350-420
LQPVELLLPSALSEQTEALIHRATSVSVQDDRIRVERMDNIYFEYSHAFQAVTEFYAKDTVDIKGSQIIS
420-490
GIVNLEKPVICSLAAIIKYLKEFNLEKMLSKPENFKQLSSKMEFMTINGTTLRNLEILQNQTDMKTKGSL
490-560
LWVLDHTKTSFGRRKLKKWVTQPLLKLREINARLDAVSEVLHSESSVFGQIENHLRKLPDIERGLCSIYH
560-630
KKCSTQEFFLIVKTLYHLKSEFQAIIPAVNSHIQSDLLRTVILEIPELLSPVEHYLKILNEQAAKVGDKT
630-700
ELFKDLSDFPLIKKRKDEIQGVIDEIRMHLQEIRKILKNPSAQYVTVSGQEFMIEIKNSAVSCIPTDWVK
700-770
VGSTKAVSRFHSPFIVENYRHLNQLREQLVLDCSAEWLDFLEKFSEHYHSLCKAVHHLATVDCIFSLAKV
770-840
AKQGDYCRPTVQEERKIVIKNGRHPVIDVLLGEQDQYVPNNTDLSEDSERVMIITGPNMGGKSSYIKQVA
840-910
LITIMAQIGSYVPAEEATIGIVDGIFTRMGAADNIYKGQSTFMEELTDTAEIIRKATSQSLVILDELGRG
910-980
TSTHDGIAIAYATLEYFIRDVKSLTLFVTHYPPVCELEKNYSHQVGNYHMGFLVSEDESKLDPGAAEQVP
980-1050
DFVTFLYQITRGIAARSYGLNVAKLADVPGEILKKAAHKSKELEGLINTKRKRLKYFAKLWTMHNAQDLQ
1050-1120
KWTEEFNMEETQTSLLH
1120-1137
MSRRKPASGGLAASSSAPARQAVLSRFFQSTGSLKSTSSSTGAADQVDPGAAAAAAAAAAAAPPAPPAPAFPPQLPPHIATEIDRRKKRPLENDGPVKKKVKKVQQKEGGSDLGMSGNSEPKKCLRTRNVSKSLEKLKEFCCDSALPQSRVQTESLQERFAVLPKCTDFDDISLLHAKNAVSSEDSKRQINQKDTTLFDLSQFGSSNTSHENLQKTASKSANKRSKSIYTPLELQYIEMKQQHKDAVLCVECGYKYRFFGEDAEIAARELNIYCHLDHNFMTASIPTHRLFVHVRRLVAKGYKVGVVKQTETAALKAIGDNRSSLFSRKLTALYTKSTLIGEDVNPLIKLDDAVNVDEIMTDTSTSYLLCISENKENVRDKKKGNIFIGIVGVQPATGEVVFDSFQDSASRSELETRMSSLQPVELLLPSALSEQTEALIHRATSVSVQDDRIRVERMDNIYFEYSHAFQAVTEFYAKDTVDIKGSQIISGIVNLEKPVICSLAAIIKYLKEFNLEKMLSKPENFKQLSSKMEFMTINGTTLRNLEILQNQTDMKTKGSLLWVLDHTKTSFGRRKLKKWVTQPLLKLREINARLDAVSEVLHSESSVFGQIENHLRKLPDIERGLCSIYHKKCSTQEFFLIVKTLYHLKSEFQAIIPAVNSHIQSDLLRTVILEIPELLSPVEHYLKILNEQAAKVGDKTELFKDLSDFPLIKKRKDEIQGVIDEIRMHLQEIRKILKNPSAQYVTVSGQEFMIEIKNSAVSCIPTDWVKVGSTKAVSRFHSPFIVENYRHLNQLREQLVLDCSAEWLDFLEKFSEHYHSLCKAVHHLATVDCIFSLAKVAKQGDYCRPTVQEERKIVIKNGRHPVIDVLLGEQDQYVPNNTDLSEDSERVMIITGPNMGGKSSYIKQVALITIMAQIGSYVPAEEATIGIVDGIFTRMGAADNIYKGQSTFMEELTDTAEIIRKATSQSLVILDELGRGTSTHDGIAIAYATLEYFIRDVKSLTLFVTHYPPVCELEKNYSHQVGNYHMGFLVSEDESKLDPGAAEQVPDFVTFLYQITRGIAARSYGLNVAKLADVPGEILKKAAHKSKELEGLINTKRKRLKYFAKLWTMHNAQDLQKWTEEFNMEETQTSLLH