You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RAB3A
Ras-related protein Rab-3A

Protein Summary
Description
Involved in exocytosis by regulating a late step in synaptic vesicle fusion. Could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000222256
  • ENSP00000222256
  • ENSG00000105649
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.99
cellular component
0.91
biological process
0.9
histone modification site profile
0.89
small molecule perturbation
0.77


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 208.83   (req: < 5)
Gene RIFs: 17   (req: <= 3)
Antibodies: 322   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 208.83   (req: >= 5)
Gene RIFs: 17   (req: > 3)
Antibodies: 322   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 35
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (24)
Acetylcholine Neurotransmitter Release Cycle (R-HSA-264642)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 19
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Acetylcholine Neurotransmitter Release Cycle
Reactome
Dopamine Neurotransmitter Release Cycle
Reactome
GABA synthesis, release, reuptake and degradation
Reactome
Glutamate Neurotransmitter Release Cycle
Reactome
Immune System
Name
Explore in Pharos
Explore in Source
Acetylcholine Neurotransmitter Release Cycle
Dopamine Neurotransmitter Release Cycle
GABA synthesis, release, reuptake and degradation
Glutamate Neurotransmitter Release Cycle
Immune System
Gene Ontology Terms (52)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (230)
1 – 10 of 230
RAB3B
Tbio
Family: Enzyme
Novelty: 0.03851756
p_int: 0.999999992
p_ni: 2e-9
p_wrong: 6e-9
Score: 0.975
Data Source: BioPlex,STRINGDB
SYTL4
Tbio
Novelty: 0.0608805
p_int: 0.999999571
p_ni: 4.19e-7
p_wrong: 1.1e-8
Score: 0.764
Data Source: BioPlex,STRINGDB
CHM
Tbio
Family: Enzyme
Novelty: 0.00301194
p_int: 0.999965688
p_ni: 0.000034312
Score: 0.97
Data Source: BioPlex,Reactome,STRINGDB
CHML
Tbio
Family: Enzyme
Novelty: 0.0116075
p_int: 0.999453493
p_ni: 0.000546506
p_wrong: 1e-9
Score: 0.954
Data Source: BioPlex,Reactome,STRINGDB
NUFIP1
Tbio
Novelty: 0.14861119
p_int: 0.999365211
p_ni: 0.000634768
p_wrong: 2.1e-8
Data Source: BioPlex
RABIF
Tbio
Novelty: 0.63157895
p_int: 0.998295603
p_ni: 0.001704175
p_wrong: 2.21e-7
Score: 0.793
Data Source: BioPlex,STRINGDB
RANGRF
Tbio
Family: Enzyme
Novelty: 0.04154228
p_int: 0.993727833
p_ni: 0.00130058
p_wrong: 0.004971587
Data Source: BioPlex
RAB33B
Tbio
Family: Enzyme
Novelty: 0.08158789
p_int: 0.987041532
p_ni: 0.012955568
p_wrong: 0.0000029
Score: 0.928
Data Source: BioPlex,STRINGDB
GDI1
Tbio
Novelty: 0.02210681
p_int: 0.985538267
p_ni: 0.014461733
Score: 0.967
Data Source: BioPlex,Reactome,STRINGDB
SLC15A1
Tchem
Family: Transporter
Novelty: 0.00170028
p_int: 0.980576687
p_ni: 0.008786226
p_wrong: 0.010637087
Score: 0.154
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  208.83

PubMed score by year
PubTator Score  135.99

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKR
1-70
IKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDME
70-140
DERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQ
140-210
QVPPHQDCAC
210-220
MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC