You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CHRM3
Muscarinic acetylcholine receptor M3

Protein Summary
Description
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover. The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 3 controls smooth muscle contraction and its stimulation causes secretion of glandular tissue. Alternative promoter use and alternative splicing results in multiple transcript variants that have different tissue specificities. [provided by RefSeq, Dec 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000255380
  • ENSP00000255380
  • ENSG00000133019
  • ENST00000615928
  • ENSP00000482377

Symbol
  • HM3
  • PBS
  • EGBRS
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug
1
ligand (chemical)
1
molecular function
0.93
biological process
0.89
biological term
0.89


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 477.38   (req: < 5)
Gene RIFs: 117   (req: <= 3)
Antibodies: 360   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 477.38   (req: >= 5)
Gene RIFs: 117   (req: > 3)
Antibodies: 360   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 21
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 910
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 59
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (30)
Acetylcholine regulates insulin secretion (R-HSA-399997)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Acetylcholine regulates insulin secretion
Reactome
Amine ligand-binding receptors
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Name
Explore in Pharos
Explore in Source
Acetylcholine regulates insulin secretion
Amine ligand-binding receptors
Class A/1 (Rhodopsin-like receptors)
G alpha (q) signalling events
GPCR downstream signalling
Gene Ontology Terms (30)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (239)
1 – 10 of 239
ATP1A4
Tclin
Family: Transporter
Novelty: 0.01551134
p_int: 0.999999788
p_ni: 3.9e-8
p_wrong: 1.73e-7
Data Source: BioPlex
TUBA3C
Tchem
Novelty: 0.08740564
p_int: 0.99999923
p_ni: 7.7e-7
Data Source: BioPlex
NOCT
Tbio
Novelty: 0.01352299
p_int: 0.999635278
p_ni: 0.000364722
Data Source: BioPlex
PLD2
Tchem
Family: Enzyme
Novelty: 0.00368183
p_int: 0.995630811
p_ni: 0.004369189
Score: 0.307
Data Source: BioPlex,STRINGDB
SLC4A7
Tbio
Family: Transporter
Novelty: 0.01401859
p_int: 0.991549564
p_ni: 0.008450432
p_wrong: 4e-9
Data Source: BioPlex
FARP2
Tbio
Novelty: 0.19204615
p_int: 0.988722114
p_ni: 0.011247175
p_wrong: 0.000030711
Data Source: BioPlex
HEATR3
Tbio
Novelty: 0.08717658
p_int: 0.988349746
p_ni: 0.011650254
Data Source: BioPlex
CAV1
Tbio
Novelty: 0.00041332
p_int: 0.986966704
p_ni: 0.002093908
p_wrong: 0.010939388
Data Source: BioPlex
YIPF4
Tbio
Novelty: 0.06083159
p_int: 0.985060761
p_ni: 0.014936763
p_wrong: 0.000002477
Data Source: BioPlex
GTPBP2
Tbio
Novelty: 0.14920071
p_int: 0.977657033
p_ni: 0.022342811
p_wrong: 1.56e-7
Data Source: BioPlex
Publication Statistics
PubMed Score  477.38

PubMed score by year
PubTator Score  470.73

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQVVF
1-70
IAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLA
70-140
CDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYF
140-210
VGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENF
210-280
VHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSA
280-350
SSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF
350-420
PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAA
420-490
QTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLL
490-560
CQCDKKKRRKQQYQQRQSVIFHKRAPEQAL
560-590
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL