You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
KLK2
Kallikrein-2

Protein Classes
Protein Summary
Description
Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. This gene encodes a member of the grandular kallikrein protein family. Kallikreins are a subgroup of serine proteases that are clustered on chromosome 19. Members of this family are involved in a diverse array of biological functions. The protein encoded by this gene is a highly active trypsin-like serine protease that selectively cleaves at arginine residues. This protein is primarily expressed in prostatic tissue and is responsible for cleaving pro-prostate-specific antigen into its enzymatically active form. This gene is highly expressed in prostate tumor cells and may be a prognostic maker for prostate cancer risk. Alternate splicing results in both coding and non-coding transcript variants. [provided by RefSeq, Jan 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000325321
  • ENSP00000313581
  • ENSG00000167751
  • ENST00000358049
  • ENSP00000350748
  • ENST00000391810
  • ENSP00000375686
  • ENST00000597439
  • ENSP00000471214

Symbol
  • hK2
  • hGK-1
  • KLK2A2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
microRNA
0.81
cell type or tissue
0.73
PubMedID
0.62
protein domain
0.58
virus perturbation
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 173.17   (req: < 5)
Gene RIFs: 34   (req: <= 3)
Antibodies: 370   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 173.17   (req: >= 5)
Gene RIFs: 34   (req: > 3)
Antibodies: 370   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 3
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (14)
Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 (R-HSA-5625886)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3
Reactome
Activation of Matrix Metalloproteinases
Reactome
Degradation of the extracellular matrix
Reactome
Extracellular matrix organization
Reactome
Metabolism of proteins
Name
Explore in Pharos
Explore in Source
Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3
Activation of Matrix Metalloproteinases
Degradation of the extracellular matrix
Extracellular matrix organization
Metabolism of proteins
Gene Ontology Terms (7)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Protein-Protein Interactions (82)
1 – 10 of 82
SERPINE2
Tbio
Novelty: 0.00275751
p_int: 0.919695626
p_ni: 0.07762684
p_wrong: 0.002677534
Score: 0.413
Data Source: BioPlex,STRINGDB
APLP2
Tbio
Novelty: 0.00824031
p_int: 0.888497515
p_ni: 0.111502485
Score: 0.578
Data Source: BioPlex,STRINGDB
GLG1
Tbio
Novelty: 0.01232832
p_int: 0.761599063
p_ni: 0.238400933
p_wrong: 4e-9
Score: 0.269
Data Source: BioPlex,STRINGDB
AR
Tclin
Family: NR
Novelty: 0.00013834
Score: 0.986
Data Source: STRINGDB
IGFBP3
Tchem
Novelty: 0.00042672
Score: 0.926
Data Source: STRINGDB
KDM1A
Tchem
Family: Epigenetic
Novelty: 0.00170368
Score: 0.921
Data Source: STRINGDB
IGF2
Tbio
Novelty: 0.00024884
Score: 0.919
Data Source: STRINGDB
MMP9
Tchem
Family: Enzyme
Novelty: 0.00010127
Score: 0.917
Data Source: STRINGDB
IGF1
Tbio
Novelty: 0.00004544
Score: 0.915
Data Source: STRINGDB
H2AFV
Tbio
Novelty: 0.06257527
Score: 0.913
Data Source: STRINGDB
Publication Statistics
PubMed Score  173.17

PubMed score by year
PubTator Score  138.6

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKN
1-70
SQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLG
70-140
LPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCG
140-210
GDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
210-261
MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP