You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HLA-DPA1
HLA class II histocompatibility antigen, DP alpha 1 chain

Protein Summary
Description
Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loa ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000374808
  • ENSP00000363941
  • ENSG00000168384
  • ENST00000383224
  • ENSP00000372711
  • ENSG00000206291
  • ENST00000415247
  • ENSP00000405838
  • ENSG00000224103
  • ENST00000419277
  • ENSP00000393566
  • ENSG00000231389
  • ENST00000422504
  • ENSP00000406250
  • ENSG00000228163
  • ENST00000443117
  • ENSP00000397587
  • ENSG00000235844
  • ENST00000454805
  • ENSP00000397139
  • ENSG00000229685
  • ENST00000515317
  • ENSP00000427429
  • ENSG00000236177

Symbol
  • HLA-DP1A
  • HLASB
  • DPA1
  • PLT1
  • HLADP
  • HLASB
  • DP(W3)
  • DP(W4)
  • HLA-DP1A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.92
phenotype
0.84
small molecule perturbation
0.81
cell type or tissue
0.77
disease
0.75


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 72.05   (req: < 5)
Gene RIFs: 41   (req: <= 3)
Antibodies: 284   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 72.05   (req: >= 5)
Gene RIFs: 41   (req: > 3)
Antibodies: 284   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (51)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Costimulation by the CD28 family
Reactome
Cytokine Signaling in Immune system
Reactome
Downstream TCR signaling
Reactome
Generation of second messenger molecules
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Costimulation by the CD28 family
Cytokine Signaling in Immune system
Downstream TCR signaling
Generation of second messenger molecules
Gene Ontology Terms (24)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Non-traceable Author Statement (NAS)
UniProtKB
Protein-Protein Interactions (368)
1 – 10 of 368
APOE
Tbio
Novelty: 0.0000621
p_int: 0.999998035
p_ni: 0.000001965
Data Source: BioPlex
NOB1
Tbio
Novelty: 0.01469497
p_int: 0.999990713
p_ni: 0.000009287
Data Source: BioPlex
DCBLD1
Tdark
Novelty: 0.40223464
p_int: 0.99997869
p_ni: 0.000021306
p_wrong: 3e-9
Score: 0.185
Data Source: BioPlex,STRINGDB
ATP13A2
Tbio
Family: Transporter
Novelty: 0.00798599
p_int: 0.999927543
p_ni: 0.000072456
p_wrong: 2e-9
Score: 0.15
Data Source: BioPlex,STRINGDB
FKTN
Tbio
Novelty: 0.00450349
p_int: 0.999699196
p_ni: 0.000300794
p_wrong: 1e-8
Score: 0.185
Data Source: BioPlex,STRINGDB
FUT4
Tbio
Family: Enzyme
Novelty: 0.00069228
p_int: 0.999565448
p_ni: 0.00000992
p_wrong: 0.000424632
Score: 0.2
Data Source: BioPlex,STRINGDB
NMU
Tbio
Novelty: 0.00347523
p_int: 0.999414358
p_ni: 0.00058562
p_wrong: 2.2e-8
Data Source: BioPlex
HBA1
Tclin
Novelty: 0.00071922
p_int: 0.999120943
p_ni: 0.000879057
Data Source: BioPlex
TYW5
Tbio
Novelty: 0.35714286
p_int: 0.998507026
p_ni: 0.001492961
p_wrong: 1.3e-8
Data Source: BioPlex
VWCE
Tbio
Novelty: 0.10129635
p_int: 0.997574153
p_ni: 0.00241833
p_wrong: 0.000007517
Data Source: BioPlex
Publication Statistics
PubMed Score  72.05

PubMed score by year
PubTator Score  110.08

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKK
1-70
ETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHI
70-140
DKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWE
140-210
AQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL
210-260
MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL