You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MYL12A
Myosin regulatory light chain 12A

Protein Summary
Description
Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion (By similarity). This gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcriptional regulator apoptosis-antagonizing transcription factor (AATF)/Che-1 which functions as a repressor of p53-driven apoptosis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8.[provided by RefSeq, Dec 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000217652
  • ENSP00000217652
  • ENSG00000101608
  • ENST00000536605
  • ENSP00000441231
  • ENST00000578611
  • ENSP00000463614
  • ENST00000579226
  • ENSP00000462171

Symbol
  • MLCB
  • MRLC3
  • RLC
  • MLCB
  • MRCL3
  • MRLC3
  • MYL2B
  • MLC-2B
  • HEL-S-24
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 88.04   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 141   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 88.04   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 141   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (13)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Developmental Biology
Reactome
EPH-Ephrin signaling
Reactome
Ephrin signaling
Reactome
Muscle contraction
Name
Explore in Pharos
Explore in Source
Axon guidance
Developmental Biology
EPH-Ephrin signaling
Ephrin signaling
Muscle contraction
Gene Ontology Terms (6)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (122)
1 – 10 of 122
S100A4
Tbio
Novelty: 0.00156469
p_int: 0.999999995
p_wrong: 5e-9
Data Source: BioPlex
MYLK
Tchem
Family: Kinase
Novelty: 0.00132404
Score: 0.996
Data Source: STRINGDB
MYH11
Tbio
Novelty: 0.00189652
Score: 0.979
Data Source: STRINGDB
MYLK2
Tchem
Family: Kinase
Novelty: 0.00918962
Score: 0.973
Data Source: STRINGDB
MYL12B
Tbio
Novelty: 0.01158157
Score: 0.966
Data Source: STRINGDB
TPM4
Tbio
Novelty: 0.00688369
Score: 0.963
Data Source: STRINGDB
TPM2
Tbio
Novelty: 0.00510926
Score: 0.96
Data Source: STRINGDB
TPM3
Tbio
Novelty: 0.00170262
Score: 0.959
Data Source: STRINGDB
TPM1
Tbio
Novelty: 0.00363188
Score: 0.957
Data Source: STRINGDB
ACTG2
Tbio
Novelty: 0.00388853
Score: 0.953
Data Source: STRINGDB
Publication Statistics
PubMed Score  88.04

PubMed score by year
PubTator Score  6.35

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLD
1-70
AMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE
70-140
LYREAPIDKKGNFNYIEFTRILKHGAKDKDD
140-171
MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD