You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
LIG1
DNA ligase 1

Protein Summary
Description
DNA ligase that seals nicks in double-stranded DNA during DNA replication, DNA recombination and DNA repair. This gene encodes a member of the ATP-dependent DNA ligase protein family. The encoded protein functions in DNA replication, recombination, and the base excision repair process. Mutations in this gene that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents. Disruption of this gene may also be associated with a variety of cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000263274
  • ENSP00000263274
  • ENSG00000105486
  • ENST00000427526
  • ENSP00000442841
  • ENST00000601091
  • ENSP00000471836
  • ENST00000613670
  • ENSP00000483027
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug perturbation
0.99
ligand (protein) perturbation
0.99
histone modification site profile
0.93
molecular function
0.93
protein domain
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 261.48   (req: < 5)
Gene RIFs: 37   (req: <= 3)
Antibodies: 492   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 261.48   (req: >= 5)
Gene RIFs: 37   (req: > 3)
Antibodies: 492   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
CHEMBL468590
chemical structure image
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (45)
Base Excision Repair (R-HSA-73884)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 32
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Base Excision Repair
Reactome
Cell Cycle
Reactome
Cell Cycle, Mitotic
Reactome
Chromosome Maintenance
Reactome
DNA Repair
Name
Explore in Pharos
Explore in Source
Base Excision Repair
Cell Cycle
Cell Cycle, Mitotic
Chromosome Maintenance
DNA Repair
Gene Ontology Terms (23)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (329)
1 – 10 of 329
RNF166
Tdark
Novelty: 0.66985646
p_int: 0.999998636
p_ni: 0.000001297
p_wrong: 6.7e-8
Score: 0.34
Data Source: BioPlex,STRINGDB
PCNA
Tchem
Novelty: 0.00995674
Score: 0.999
Data Source: Reactome,STRINGDB
FEN1
Tchem
Family: Enzyme
Novelty: 0.00147856
Score: 0.999
Data Source: STRINGDB
POLD1
Tclin
Family: Enzyme
Novelty: 0.00751863
Score: 0.996
Data Source: Reactome,STRINGDB
POLE
Tclin
Family: Enzyme
Novelty: 0.00492007
Score: 0.996
Data Source: STRINGDB
RFC4
Tbio
Novelty: 0.05335859
Score: 0.992
Data Source: STRINGDB
APEX1
Tchem
Family: Enzyme
Novelty: 0.00035132
Score: 0.988
Data Source: Reactome,STRINGDB
RFC1
Tbio
Novelty: 0.0408089
Score: 0.987
Data Source: STRINGDB
RFC5
Tbio
Novelty: 0.07603566
Score: 0.986
Data Source: STRINGDB
RPA1
Tchem
Novelty: 0.00309278
Score: 0.984
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  261.48

PubMed score by year
PubTator Score  46.7

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKAARVLGSEGEE
1-70
EDEALSPAKGQKPALDCSQVSPPRPATSPENNASLSDTSPMDSSPSGIPKRRTARKQLPKRTIQEVLEEQ
70-140
SEDEDREAKRKKEEEEEETPKESLTEAEVATEKEGEDGDQPTTPPKPLKTSKAETPTESVSEPEVATKQE
140-210
LQEEEEQTKPPRRAPKTLSSFFTPRKPAVKKEVKEEEPGAPGKEGAAEGPLDPSGYNPAKNNYHPVEDAC
210-280
WKPGQKVPYLAVARTFEKIEEVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVG
280-350
DGVLLKAVAQATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSAST
350-420
AKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAMVDAGKGKTAE
420-490
ARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPLKPMLAHPTRGISEVLKRFEE
490-560
AAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDREKK
560-630
QIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLD
630-700
TKDIEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGK
700-770
RAGRYGGFLLASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSA
770-840
VWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQSQIQNQQGED
840-910
SGSDPEDTY
910-919
MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKAARVLGSEGEEEDEALSPAKGQKPALDCSQVSPPRPATSPENNASLSDTSPMDSSPSGIPKRRTARKQLPKRTIQEVLEEQSEDEDREAKRKKEEEEEETPKESLTEAEVATEKEGEDGDQPTTPPKPLKTSKAETPTESVSEPEVATKQELQEEEEQTKPPRRAPKTLSSFFTPRKPAVKKEVKEEEPGAPGKEGAAEGPLDPSGYNPAKNNYHPVEDACWKPGQKVPYLAVARTFEKIEEVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVGDGVLLKAVAQATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSASTAKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAMVDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPLKPMLAHPTRGISEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSAVWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQSQIQNQQGEDSGSDPEDTY