You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ADCYAP1
Pituitary adenylate cyclase-activating polypeptide

Protein Summary
Description
Binding to its receptor activates G proteins and stimulates adenylate cyclase in pituitary cells. Promotes neuron projection development through the RAPGEF2/Rap1/B-Raf/ERK pathway. In chromaffin cells, induces long-lasting increase of intracellular calcium concentrations and neuroendocrine secretion (By similarity). Involved in the control of glucose homeostasis, induces insulin secretion by pancreatic beta cells (By similarity). This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000450565
  • ENSP00000411658
  • ENSG00000141433
  • ENST00000579794
  • ENSP00000462647

Symbol
  • PACAP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
co-expressed gene
1
gene perturbation
0.9
biological term
0.76
microRNA
0.7


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1301.17   (req: < 5)
Gene RIFs: 82   (req: <= 3)
Antibodies: 252   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1301.17   (req: >= 5)
Gene RIFs: 82   (req: > 3)
Antibodies: 252   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 49
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (18)
Activation of TRKA receptors (R-HSA-187015)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of TRKA receptors
Reactome
Class B/2 (Secretin family receptors)
Reactome
G alpha (s) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Name
Explore in Pharos
Explore in Source
Activation of TRKA receptors
Class B/2 (Secretin family receptors)
G alpha (s) signalling events
GPCR downstream signalling
GPCR ligand binding
Gene Ontology Terms (55)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (219)
1 – 10 of 219
NUCB1
Tchem
Novelty: 0.00141462
p_int: 0.999998175
p_ni: 0.000001825
Score: 0.191
Data Source: BioPlex,STRINGDB
PCSK1N
Tbio
Novelty: 0.0045381
p_int: 0.999991805
p_ni: 0.000008167
p_wrong: 2.8e-8
Score: 0.374
Data Source: BioPlex,STRINGDB
SAV1
Tbio
Novelty: 0.01342169
p_int: 0.999803309
p_ni: 0.000196655
p_wrong: 3.6e-8
Score: 0.663
Data Source: BioPlex,STRINGDB
TIMM10B
Tdark
Family: Enzyme
Novelty: 0.92307692
p_int: 0.999385906
p_ni: 0.000011052
p_wrong: 0.000603043
Score: 0.235
Data Source: BioPlex,STRINGDB
GCC2
Tbio
Novelty: 0.07813275
p_int: 0.989876329
p_ni: 0.010123671
Score: 0.171
Data Source: BioPlex,STRINGDB
COPRS
Tbio
Novelty: 0.06881767
p_int: 0.982531523
p_ni: 0.00085894
p_wrong: 0.016609537
Data Source: BioPlex
APBB2
Tbio
Novelty: 0.09429731
p_int: 0.969936774
p_ni: 0.029901149
p_wrong: 0.000162078
Data Source: BioPlex
AMD1
Tchem
Family: Enzyme
Novelty: 0.00107659
p_int: 0.934128124
p_ni: 0.065871876
Data Source: BioPlex
STK3
Tchem
Family: Kinase
Novelty: 0.09293063
p_int: 0.900101045
p_ni: 0.099898955
Score: 0.663
Data Source: BioPlex,STRINGDB
GGPS1
Tchem
Family: Enzyme
Novelty: 0.00446019
p_int: 0.896067607
p_ni: 0.103932392
Data Source: BioPlex
Publication Statistics
PubMed Score  1301.17

PubMed score by year
PubTator Score  592.76

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRA
1-70
AAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDS
70-140
YSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
140-176
MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL