You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
SRD5A1
3-oxo-5-alpha-steroid 4-dehydrogenase 1

Protein Summary
Description
Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology. Steroid 5-alpha-reductase (EC 1.3.99.5) catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). Also see SRD5A2 (MIM 607306).[supplied by OMIM, Mar 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000274192
  • ENSP00000274192
  • ENSG00000145545

Symbol
  • S5AR 1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.87
transcription factor perturbation
0.8
transcription factor binding site profile
0.77
kinase perturbation
0.76
virus perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 66.54   (req: < 5)
Gene RIFs: 59   (req: <= 3)
Antibodies: 158   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 66.54   (req: >= 5)
Gene RIFs: 59   (req: > 3)
Antibodies: 158   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 40
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 323
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Pathways (7)
Androgen biosynthesis (R-HSA-193048)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Androgen biosynthesis
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Metabolism of steroid hormones
Reactome
Metabolism of steroids
Name
Explore in Pharos
Explore in Source
Androgen biosynthesis
Metabolism
Metabolism of lipids
Metabolism of steroid hormones
Metabolism of steroids
Gene Ontology Terms (47)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (70)
1 – 10 of 70
ACTBL2
Tbio
Novelty: 0.35273907
p_int: 0.932864192
p_ni: 0.067135808
Score: 0.172
Data Source: BioPlex,STRINGDB
SRD5A3
Tbio
Family: Enzyme
Novelty: 0.04797538
Score: 0.979
Data Source: STRINGDB
HSD17B3
Tchem
Family: Enzyme
Novelty: 0.00916785
Score: 0.977
Data Source: STRINGDB
AKR1C3
Tchem
Family: Enzyme
Novelty: 0.00230684
Score: 0.972
Data Source: STRINGDB
CYP17A1
Tclin
Family: Enzyme
Novelty: 0.00077909
Score: 0.972
Data Source: STRINGDB
HSD3B2
Tclin
Family: Enzyme
Novelty: 0.00875526
Score: 0.97
Data Source: STRINGDB
HSD3B1
Tchem
Family: Enzyme
Novelty: 0.0023452
Score: 0.97
Data Source: STRINGDB
HSD17B6
Tbio
Family: Enzyme
Novelty: 0.00841501
Score: 0.969
Data Source: STRINGDB
AKR1C1
Tchem
Family: Enzyme
Novelty: 0.00543961
Score: 0.965
Data Source: STRINGDB
CYP19A1
Tclin
Family: Enzyme
Novelty: 0.0003927
Score: 0.965
Data Source: STRINGDB
Publication Statistics
PubMed Score  66.54

PubMed score by year
PubTator Score  58.55

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQ
1-70
YASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAV
70-140
YADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYA
140-210
LASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF
210-259
MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF