Protein Classes
Protein Summary
Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis (By similarity). In the nucleus: acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells. Together with TRIM16, coordinates the recognition of membrane damage with mobilization of the core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes. This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition doma ...more
- ENST00000254301
- ENSP00000254301
- ENSG00000131981
- MAC2
- L31
- GAL3
- MAC2
- CBP35
- GALBP
- GALIG
- LGALS2
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
|---|---|---|---|
PubMedID | 1 | ||
biological process | 0.93 | ||
biological term | 0.86 | ||
kinase perturbation | 0.84 | ||
disease | 0.78 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 3170.43 (req: < 5)
Gene RIFs: 609 (req: <= 3)
Antibodies: 1455 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 3170.43 (req: >= 5)
Gene RIFs: 609 (req: > 3)
Antibodies: 1455 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 35
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligands: 23
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Active Ligands (23)
1 – 10 of 23
Protein Data Bank (56)
1 – 5 of 56
PDB Structure Id | Ligand | Method | Resolution (Å) | M.W. (kDa) | Pub Year | Title |
|---|
PDB Structure Id | M.W. | Resolution | Pub Year |
|---|
Pathways (32)
Reactome (11)
PathwayCommons (2)
WikiPathways (19)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 11
Data Source | Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|---|
Reactome | Advanced glycosylation endproduct receptor signaling | ||||
Reactome | Gene expression (Transcription) | ||||
Reactome | Generic Transcription Pathway | ||||
Reactome | Immune System | ||||
Reactome | Innate Immune System | ||||
Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|
Advanced glycosylation endproduct receptor signaling | ||||
Gene expression (Transcription) | ||||
Generic Transcription Pathway | ||||
Immune System | ||||
Innate Immune System | ||||
Gene Ontology Terms (50)
Functions (8)
Components (15)
Processes (27)
Items per page:
10
1 – 8 of 8
GO Term | Evidence | Assigned by | ||
|---|---|---|---|---|
Inferred from Direct Assay (IDA) | BHF-UCL | |||
Inferred from Direct Assay (IDA) | BHF-UCL | |||
Inferred from Direct Assay (IDA) | BHF-UCL | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Physical Interaction (IPI) | ARUK-UCL | |||
Inferred from High Throughput Direct Assay (HDA) | UniProtKB | |||
Traceable Author Statement (TAS) | ProtInc | |||
Inferred by Curator (IC) | ARUK-UCL | |||
Protein-Protein Interactions (310)
1 – 10 of 310
SDK1
Novelty: 0.09921467
p_int: 0.999999932
p_ni: 1.3e-8
p_wrong: 5.5e-8
Score: 0.179
Data Source: BioPlex,STRINGDB
CSPG4
Novelty: 0.00426568
p_int: 0.999999648
p_ni: 3.24e-7
p_wrong: 2.7e-8
Score: 0.63
Data Source: BioPlex,STRINGDB
PTPRJ
Family: Enzyme
Novelty: 0.00998711
p_int: 0.999999223
p_ni: 2.31e-7
p_wrong: 5.47e-7
Score: 0.299
Data Source: BioPlex,STRINGDB
SLC12A6
Family: Transporter
Novelty: 0.01603861
p_int: 0.999999147
p_ni: 8.53e-7
Score: 0.297
Data Source: BioPlex,STRINGDB
LAMA1
Novelty: 0.01015308
p_int: 0.999998928
p_ni: 0.000001062
p_wrong: 1e-8
Score: 0.6
Data Source: BioPlex,STRINGDB
SDK2
Novelty: 0.28691494
p_int: 0.999998879
p_ni: 0.00000112
Data Source: BioPlex
KIAA1549
Novelty: 0.01648616
p_int: 0.999998723
p_ni: 3e-9
p_wrong: 0.000001274
Score: 0.251
Data Source: BioPlex,STRINGDB
ITGA1
Novelty: 0.00994526
p_int: 0.999998433
p_ni: 0.00000155
p_wrong: 1.7e-8
Score: 0.351
Data Source: BioPlex,STRINGDB
LAMA4
Novelty: 0.02106699
p_int: 0.999998431
p_ni: 0.000001569
Score: 0.235
Data Source: BioPlex,STRINGDB
COLEC12
Novelty: 0.00845079
p_int: 0.999989813
p_ni: 0.000010187
Score: 0.237
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score 3170.43
PubMed score by year
PubTator Score 1911.76
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAY
1-70
PGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKP
70-140
NANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFK
140-210
VAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
210-250
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Find similar targets by: