You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CHRNB2
Neuronal acetylcholine receptor subunit beta-2

Protein Classes
Protein Summary
Description
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane permeable to sodiun ions. Neuronal acetylcholine receptors are homo- or heteropentameric complexes composed of homologous alpha and beta subunits. They belong to a superfamily of ligand-gated ion channels which allow the flow of sodium and potassium across the plasma membrane in response to ligands such as acetylcholine and nicotine. This gene encodes one of several beta subunits. Mutations in this gene are associated with autosomal dominant nocturnal frontal lobe epilepsy. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000368476
  • ENSP00000357461
  • ENSG00000160716

Symbol
  • EFNL3
  • nAChRB2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.99
molecular function
0.98
chemical
0.96
protein domain
0.85
biological term
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 41.9   (req: < 5)
Gene RIFs: 78   (req: <= 3)
Antibodies: 246   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 41.9   (req: >= 5)
Gene RIFs: 78   (req: > 3)
Antibodies: 246   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 54
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Protein Data Bank (8)
1 – 5 of 8
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (18)
Acetylcholine binding and downstream events (R-HSA-181431)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Acetylcholine binding and downstream events
Reactome
Highly calcium permeable nicotinic acetylcholine receptors
Reactome
Highly calcium permeable postsynaptic nicotinic acetylcholine receptors
Reactome
Highly sodium permeable acetylcholine nicotinic receptors
Reactome
Neuronal System
Name
Explore in Pharos
Explore in Source
Acetylcholine binding and downstream events
Highly calcium permeable nicotinic acetylcholine receptors
Highly calcium permeable postsynaptic nicotinic acetylcholine receptors
Highly sodium permeable acetylcholine nicotinic receptors
Neuronal System
Gene Ontology Terms (67)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Traceable Author Statement (TAS)
DFLAT
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (69)
1 – 10 of 69
CHRNB4
Tclin
Family: IC
Novelty: 0.02388015
Score: 0.981
Data Source: STRINGDB
CHRNA4
Tclin
Family: IC
Novelty: 0.00260286
Score: 0.966
Data Source: Reactome,STRINGDB
CHRNA2
Tchem
Family: IC
Novelty: 0.03966016
Score: 0.96
Data Source: STRINGDB
CHRNA3
Tclin
Family: IC
Novelty: 0.00918226
Score: 0.956
Data Source: Reactome,STRINGDB
CHRNA5
Tbio
Family: IC
Novelty: 0.0060853
Score: 0.956
Data Source: Reactome,STRINGDB
CHRNA7
Tchem
Family: IC
Novelty: 0.00717396
Score: 0.937
Data Source: STRINGDB
CHRNA6
Tchem
Family: IC
Novelty: 0.05805561
Score: 0.932
Data Source: STRINGDB
CHRNA9
Tchem
Family: IC
Novelty: 0.07858477
Score: 0.912
Data Source: STRINGDB
CHRNB3
Tchem
Family: IC
Novelty: 0.04622453
Score: 0.911
Data Source: STRINGDB
CHRNE
Tclin
Family: IC
Novelty: 0.01820975
Score: 0.91
Data Source: STRINGDB
Publication Statistics
PubMed Score  41.90

PubMed score by year
PubTator Score  41.48

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV
1-70
HEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYD
70-140
GSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPG
140-210
RRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFL
210-280
LLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQ
280-350
QPRHHCARQRLRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPC
350-420
GCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQPLFQNYTTTT
420-490
FLHSDHSAPSSK
490-502
MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQRLRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPCGCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQPLFQNYTTTTFLHSDHSAPSSK