You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HLA-G
HLA class I histocompatibility antigen, alpha chain G

Protein Summary
Description
Isoform 1: Non-classical major histocompatibility class Ib molecule involved in immune regulatory processes at the maternal-fetal interface (PubMed:23184984, PubMed:29262349, PubMed:19304799). In complex with B2M/beta-2 microglobulin binds a limited repertoire of nonamer self-peptides derived from intracellular proteins including histones and ribosomal proteins (PubMed:7584149, PubMed:8805247). Peptide-bound HLA-G-B2M complex acts as a ligand for inhibitory/activating KIR2DL4, LILRB1 and LILRB2 receptors on uterine immune cells to promote fetal development while maintaining maternal-fetal tolerance (PubMed:23184984, PubMed:29262349, PubMed:16366734, PubMed:19304799, PubMed:20448110, PubMed:27859042). Upon interaction with KIR2DL4 and LILRB1 receptors on decidual NK cells, it triggers NK cell senescence-associated secretory phenotype as a molecular switch to promote vascular remodeling and fetal growth in early pregnancy (PubMed:23184984, PubMed:29262349, PubMed:16366734, PubMed:1930479 ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000360323
  • ENSP00000353472
  • ENSG00000204632
  • ENST00000376815
  • ENSP00000366011
  • ENST00000383621
  • ENSP00000373116
  • ENSG00000206506
  • ENST00000383622
  • ENSP00000373117
  • ENST00000415687
  • ENSP00000389969
  • ENSG00000237216
  • ENST00000423011
  • ENSP00000389522
  • ENSG00000233095
  • ENST00000423373
  • ENSP00000405238
  • ENSG00000235346
  • ENST00000428701
  • ENSP00000412927
  • ENST00000428952
  • ENSP00000388176
  • ENSG00000235680
  • ENST00000429890
  • ENSP00000401326
  • ENST00000444098
  • ENSP00000398200
  • ENSG00000230413
  • ENST00000445373
  • ENSP00000416408
  • ENST00000448306
  • ENSP00000413926
  • ENST00000449127
  • ENSP00000408773
  • ENST00000457132
  • ENSP00000410247
  • ENST00000546545
  • ENSP00000447762
  • ENST00000546634
  • ENSP00000447780
  • ENST00000547241
  • ENSP00000448085
  • ENST00000547931
  • ENSP00000448363
  • ENST00000550897
  • ENSP00000449903
  • ENST00000553052
  • ENSP00000449291
  • ENST00000622601
  • ENSP00000479399
  • ENSG00000276051

Symbol
  • HLA-6.0
  • HLAG
  • MHC-G
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
1
virus perturbation
1
protein domain
0.97
cellular component
0.94
disease
0.91


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1381.88   (req: < 5)
Gene RIFs: 641   (req: <= 3)
Antibodies: 1368   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1381.88   (req: >= 5)
Gene RIFs: 641   (req: > 3)
Antibodies: 1368   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 22
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (8)
1 – 5 of 8
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (36)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Antigen Presentation: Folding, assembly and peptide loading of class I MHC
Reactome
Antigen processing-Cross presentation
Reactome
Class I MHC mediated antigen processing & presentation
Reactome
Cytokine Signaling in Immune system
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Antigen Presentation: Folding, assembly and peptide loading of class I MHC
Antigen processing-Cross presentation
Class I MHC mediated antigen processing & presentation
Cytokine Signaling in Immune system
Protein-Protein Interactions (272)
1 – 10 of 272
HLA-A
Tbio
Novelty: 0.00378961
p_int: 0.99952393
p_ni: 0.00047607
Score: 0.982
Data Source: BioPlex,STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
p_int: 0.999293414
p_ni: 0.000706586
Score: 0.981
Data Source: BioPlex,STRINGDB
HLA-A
Tbio
Novelty: 0.00378961
p_int: 0.99820539
p_ni: 0.00179461
Score: 0.982
Data Source: BioPlex,STRINGDB
HLA-F
Tbio
Novelty: 0.01349191
p_int: 0.997522974
p_ni: 0.002477026
Score: 0.987
Data Source: BioPlex,STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
p_int: 0.993953561
p_ni: 0.006046439
Score: 0.969
Data Source: BioPlex,STRINGDB
HLA-E
Tbio
Novelty: 0.00263667
p_int: 0.988282919
p_ni: 0.011717081
Score: 0.969
Data Source: BioPlex,STRINGDB
PRXL2A
Tchem
Novelty: 0.01908076
p_int: 0.871904658
p_ni: 0.128095342
Score: 0.613
Data Source: BioPlex,STRINGDB
B2M
Tbio
Novelty: 0.00012184
Score: 0.998
Data Source: Reactome,STRINGDB
LILRB2
Tbio
Novelty: 0.00812824
Score: 0.998
Data Source: STRINGDB
LILRB1
Tbio
Novelty: 0.0062396
Score: 0.993
Data Source: STRINGDB
Publication Statistics
PubMed Score  1381.88

PubMed score by year
PubTator Score  2190.49

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRME
1-70
PRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQY
70-140
AYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPK
140-210
THVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQR
210-280
YTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
280-338
MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD