You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ITGA2
Integrin alpha-2

Protein Summary
Description
Integrin alpha-2/beta-1 is a receptor for laminin, collagen, collagen C-propeptides, fibronectin and E-cadherin. It recognizes the proline-hydroxylated sequence G-F-P-G-E-R in collagen. It is responsible for adhesion of platelets and other cells to collagens, modulation of collagen and collagenase gene expression, force generation and organization of newly synthesized extracellular matrix. (Microbial infection) Integrin ITGA2:ITGB1 acts as a receptor for Human rotavirus A. (Microbial infection) Integrin ITGA2:ITGB1 acts as a receptor for Human echoviruses 1 and 8. This gene encodes the alpha subunit of a transmembrane receptor for collagens and related proteins. The encoded protein forms a heterodimer with a beta subunit and mediates the adhesion of platelets and other cell types to the extracellular matrix. Loss of the encoded protein is associated with bleeding disorder platelet-type 9. Antibodies against this protein are found in several immune disorders, including neonatal alloimmu ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000296585
  • ENSP00000296585
  • ENSG00000164171

Symbol
  • CD49B
  • BR
  • GPIa
  • CD49B
  • HPA-5
  • VLA-2
  • VLAA2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.99
biological term
0.99
gene perturbation
0.95
molecular function
0.86
protein domain
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 437.81   (req: < 5)
Gene RIFs: 232   (req: <= 3)
Antibodies: 1284   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 437.81   (req: >= 5)
Gene RIFs: 232   (req: > 3)
Antibodies: 1284   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 55
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (7)
1 – 5 of 7
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (259)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 17
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
CHL1 interactions
Reactome
Developmental Biology
Reactome
ECM proteoglycans
Reactome
Extracellular matrix organization
Name
Explore in Pharos
Explore in Source
Axon guidance
CHL1 interactions
Developmental Biology
ECM proteoglycans
Extracellular matrix organization
Gene Ontology Terms (65)
Items per page:
10
1 – 10 of 11
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
ARUK-UCL
Traceable Author Statement (TAS)
ARUK-UCL
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (236)
1 – 10 of 236
LGALS8
Tchem
Novelty: 0.00746585
p_int: 0.999999167
p_ni: 8.32e-7
Data Source: BioPlex
BTNL8
Tdark
Novelty: 0.35087719
p_int: 0.999993751
p_ni: 0.000006249
Data Source: BioPlex
MGAT4C
Tbio
Family: Enzyme
Novelty: 0.0221593
p_int: 0.997838237
p_ni: 0.00216161
p_wrong: 1.53e-7
Data Source: BioPlex
EDDM3B
Tdark
Novelty: 0.07909894
p_int: 0.996628845
p_ni: 0.003298579
p_wrong: 0.000072576
Data Source: BioPlex
LGALS3
Tchem
Novelty: 0.00032884
p_int: 0.994410203
p_ni: 0.005582239
p_wrong: 0.000007558
Score: 0.259
Data Source: BioPlex,STRINGDB
TMED6
Tdark
Novelty: 0.61538462
p_int: 0.992596317
p_ni: 0.007268902
p_wrong: 0.000134782
Data Source: BioPlex
SCGB1D1
Tbio
Novelty: 0.00676385
p_int: 0.989638536
p_ni: 0.01030757
p_wrong: 0.000053895
Data Source: BioPlex
ADAM18
Tdark
Family: Enzyme
Novelty: 0.24489796
p_int: 0.96693406
p_ni: 0.033044539
p_wrong: 0.0000214
Data Source: BioPlex
CD160
Tbio
Novelty: 0.02046796
p_int: 0.959889276
p_ni: 0.040103897
p_wrong: 0.000006827
Data Source: BioPlex
SERPINA12
Tbio
Novelty: 0.00636095
p_int: 0.959160053
p_ni: 0.036830624
p_wrong: 0.004009323
Data Source: BioPlex
Publication Statistics
PubMed Score  437.81

PubMed score by year
PubTator Score  312.5

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGPERTGAAPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWS
1-70
GFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLILTRNMGTGGFLTCGPLWAQQCG
70-140
NQYYTTGVCSDISPDFQLSASFSPATQPCPSLIDVVVVCDESNSIYPWDAVKNFLEKFVQGLDIGPTKTQ
140-210
VGLIQYANNPRVVFNLNTYKTKEEMIVATSQTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVV
210-280
VTDGESHDGSMLKAVIDQCNHDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAAL
280-350
LEKAGTLGEQIFSIEGTVQGGDNFQMEMSQVGFSADYSSQNDILMLGAVGAFGWSGTIVQKTSHGHLIFP
350-420
KQAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNITVIQAHRGDQIGSY
420-490
FGSVLCSVDVDKDTITDVLLVGAPMYMSDLKKEEGRVYLFTIKKGILGQHQFLEGPEGIENTRFGSAIAA
490-560
LSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQGTIRTKYSQKILGSDGAFRSHLQYFGRSLDGYGDLNG
560-630
DSITDVSIGAFGQVVQLWSQSIADVAIEASFTPEKITLVNKNAQIILKLCFSAKFRPTKQNNQVAIVYNI
630-700
TLDADGFSSRVTSRGLFKENNERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPA
700-770
LEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTG
770-840
IVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQNLQNQASLSF
840-910
QALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSIVHSFEDVGPKFIFSLKVTTG
910-980
SVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCNADINPLKIGQTSSSVSFKSENFRHTKELNC
980-1050
RTASCSNVTCWLKDVHMKGEYFVNVTTRIWNGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLM
1050-1120
IMKPDEKAEVPTGVIIGSIIAGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS
1120-1181
MGPERTGAAPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLILTRNMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISPDFQLSASFSPATQPCPSLIDVVVVCDESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATSQTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCNHDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQIFSIEGTVQGGDNFQMEMSQVGFSADYSSQNDILMLGAVGAFGWSGTIVQKTSHGHLIFPKQAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNITVIQAHRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMSDLKKEEGRVYLFTIKKGILGQHQFLEGPEGIENTRFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQGTIRTKYSQKILGSDGAFRSHLQYFGRSLDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADVAIEASFTPEKITLVNKNAQIILKLCFSAKFRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKENNERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSIVHSFEDVGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCNADINPLKIGQTSSSVSFKSENFRHTKELNCRTASCSNVTCWLKDVHMKGEYFVNVTTRIWNGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSIIAGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS