You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NPPB
Natriuretic peptides B

Protein Summary
Description
Cardiac hormone which may function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascular homeostasis through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3. This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Mutations in this gene have been associated with postmenopausal ost ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000376468
  • ENSP00000365651
  • ENSG00000120937

Symbol
  • BNP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
1
disease
0.84
cell type or tissue
0.81
PubMedID
0.81
biological process
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2459.42   (req: < 5)
Gene RIFs: 942   (req: <= 3)
Antibodies: 1373   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2459.42   (req: >= 5)
Gene RIFs: 942   (req: > 3)
Antibodies: 1373   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
KEGG
Thermogenesis
KEGG
Vascular smooth muscle contraction
KEGG
cGMP-PKG signaling pathway
Name
Explore in Pharos
Explore in Source
Thermogenesis
Vascular smooth muscle contraction
cGMP-PKG signaling pathway
Protein-Protein Interactions (91)
1 – 10 of 91
ITPRID2
Tbio
Novelty: 0.06728433
p_int: 0.999963586
p_ni: 0.000036414
Data Source: BioPlex
TCAF2
Tbio
Family: Enzyme
Novelty: 1.15662651
p_int: 0.999927397
p_ni: 0.000072603
Data Source: BioPlex
C1GALT1
Tbio
Family: Enzyme
Novelty: 0.01514342
p_int: 0.999792505
p_ni: 0.000204179
p_wrong: 0.000003316
Data Source: BioPlex
RFLNB
Tbio
Novelty: 0.11914894
p_int: 0.996961602
p_ni: 0.000202663
p_wrong: 0.002835735
Data Source: BioPlex
NDUFAF5
Tbio
Family: Enzyme
Novelty: 0.19033233
p_int: 0.996831997
p_ni: 0.003167996
p_wrong: 6e-9
Data Source: BioPlex
FARS2
Tchem
Family: Enzyme
Novelty: 0.00598403
p_int: 0.964471999
p_ni: 0.035528001
Data Source: BioPlex
ITPR3
Tchem
Family: IC
Novelty: 0.00274855
p_int: 0.894899215
p_ni: 0.105100784
Data Source: BioPlex
FAT4
Tbio
Novelty: 0.01665267
p_int: 0.892260649
p_ni: 0.107739351
Data Source: BioPlex
PMPCB
Tbio
Family: Enzyme
Novelty: 0.01482597
p_int: 0.768104022
p_ni: 0.231895978
Data Source: BioPlex
NPR3
Tchem
Novelty: 0.00281298
Score: 0.964
Data Source: STRINGDB
Publication Statistics
PubMed Score  2459.42

PubMed score by year
PubTator Score  5635.36

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQES
1-70
PRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
70-134
MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH