You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
DPEP1
Dipeptidase 1

Protein Summary
Description
Hydrolyzes a wide range of dipeptides. Implicated in the renal metabolism of glutathione and its conjugates. Converts leukotriene D4 to leukotriene E4; it may play an important role in the regulation of leukotriene activity. The protein encoded by this gene is a kidney membrane enzyme involved in the metabolism of glutathione and other similar proteins by dipeptide hydrolysis. The encoded protein is known to regulate leukotriene activity by catalyzing the conversion of leukotriene D4 to leukotriene E4. This protein uses zinc as a cofactor and acts as a disulfide-linked homodimer. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000261615
  • ENSP00000261615
  • ENSG00000015413
  • ENST00000393092
  • ENSP00000376807
  • ENST00000421184
  • ENSP00000397313

Symbol
  • MDP
  • RDP
  • MDP
  • RDP
  • MBD1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.98
biological process
0.83
cellular component
0.83
gene perturbation
0.7
disease perturbation
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 300.71   (req: < 5)
Gene RIFs: 10   (req: <= 3)
Antibodies: 202   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 300.71   (req: >= 5)
Gene RIFs: 10   (req: > 3)
Antibodies: 202   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 19
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
cilastatin
chemical structure image
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (11)
Aflatoxin activation and detoxification (R-HSA-5423646)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Aflatoxin activation and detoxification
Reactome
Arachidonic acid metabolism
Reactome
Biological oxidations
Reactome
Fatty acid metabolism
Reactome
Metabolism
Name
Explore in Pharos
Explore in Source
Aflatoxin activation and detoxification
Arachidonic acid metabolism
Biological oxidations
Fatty acid metabolism
Metabolism
Gene Ontology Terms (29)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (89)
1 – 10 of 89
TMUB2
Tdark
Novelty: 15
p_int: 0.999999633
p_ni: 3.67e-7
Data Source: BioPlex
FANCG
Tbio
Novelty: 0.00411649
p_int: 0.999996382
p_ni: 0.000003618
Data Source: BioPlex
ORC5
Tbio
Novelty: 0.03045299
p_int: 0.999994922
p_ni: 0.000005078
Data Source: BioPlex
SUN1
Tbio
Novelty: 0.01341889
p_int: 0.999992963
p_ni: 0.000007036
p_wrong: 1e-9
Data Source: BioPlex
FLCN
Tbio
Novelty: 0.00262361
p_int: 0.999988829
p_ni: 0.000011171
Data Source: BioPlex
STEAP3
Tbio
Family: Enzyme
Novelty: 0.0328697
p_int: 0.999952402
p_ni: 0.000047498
p_wrong: 1.01e-7
Data Source: BioPlex
NCAPD2
Tbio
Novelty: 0.06610167
p_int: 0.999951506
p_ni: 0.000048494
Data Source: BioPlex
PIGA
Tbio
Family: Enzyme
Novelty: 0.00206685
p_int: 0.999916938
p_ni: 0.000083062
Data Source: BioPlex
NCAPG
Tbio
Novelty: 0.02311432
p_int: 0.999891887
p_ni: 0.000108113
Data Source: BioPlex
C1GALT1
Tbio
Family: Enzyme
Novelty: 0.01514342
p_int: 0.999766073
p_ni: 0.00023366
p_wrong: 2.67e-7
Data Source: BioPlex
Publication Statistics
PubMed Score  300.71

PubMed score by year
PubTator Score  178.57

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPK
1-70
LRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGV
70-140
EGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLI
140-210
DLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANL
210-280
SQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVF
280-350
EAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSSGASSLHRHWGLLLASLAPLVLCLSLL
350-411
MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSSGASSLHRHWGLLLASLAPLVLCLSLL