You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ABO
Histo-blood group ABO system transferase

Protein Summary
Description
This protein is the basis of the ABO blood group system. The histo-blood group ABO involves three carbohydrate antigens: A, B, and H. A, B, and AB individuals express a glycosyltransferase activity that converts the H antigen to the A antigen (by addition of UDP-GalNAc) or to the B antigen (by addition of UDP-Gal), whereas O individuals lack such activity. This gene encodes proteins related to the first discovered blood group system, ABO. Which allele is present in an individual determines the blood group. The 'O' blood group is caused by a deletion of guanine-258 near the N-terminus of the protein which results in a frameshift and translation of an almost entirely different protein. Individuals with the A, B, and AB alleles express glycosyltransferase activities that convert the H antigen into the A or B antigen. Other minor alleles have been found for this gene. [provided by RefSeq, Jul 2008]
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
1
trait
1
tissue sample
0.92
disease
0.87
cellular component
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2176.96   (req: < 5)
Gene RIFs: 102   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2176.96   (req: >= 5)
Gene RIFs: 102   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (142)
1 – 5 of 142
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (9)
ABO blood group biosynthesis (R-HSA-9033807)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
ABO blood group biosynthesis
Reactome
Blood group systems biosynthesis
Reactome
Metabolism
Reactome
Metabolism of carbohydrates
Name
Explore in Pharos
Explore in Source
ABO blood group biosynthesis
Blood group systems biosynthesis
Metabolism
Metabolism of carbohydrates
Gene Ontology Terms (14)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Mutant Phenotype (IMP)
CAFA
Inferred from Mutant Phenotype (IMP)
CAFA
Inferred from Mutant Phenotype (IMP)
CAFA
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Protein-Protein Interactions (58)
1 – 10 of 58
FUT2
Tbio
Family: Enzyme
Novelty: 0.00082764
Score: 0.966
Data Source: STRINGDB
FUT1
Tbio
Family: Enzyme
Novelty: 0.00748704
Score: 0.957
Data Source: STRINGDB
FUT3
Tbio
Family: Enzyme
Novelty: 0.00272149
Score: 0.934
Data Source: STRINGDB
FUT4
Tbio
Family: Enzyme
Novelty: 0.00069228
Score: 0.913
Data Source: STRINGDB
FUT5
Tbio
Family: Enzyme
Novelty: 0.03114594
Score: 0.905
Data Source: STRINGDB
FUT6
Tchem
Family: Enzyme
Novelty: 0.01495318
Score: 0.905
Data Source: STRINGDB
FUT9
Tbio
Family: Enzyme
Novelty: 0.03327185
Score: 0.901
Data Source: STRINGDB
NONO
Tbio
Novelty: 0.00181733
Score: 0.86
Data Source: STRINGDB
ASS1
Tbio
Family: Enzyme
Novelty: 0.00451148
Score: 0.806
Data Source: STRINGDB
VWF
Tbio
Novelty: 0.00010911
Score: 0.708
Data Source: STRINGDB
Publication Statistics
PubMed Score  2176.96

PubMed score by year
PubTator Score  5917.36

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDHLQRVSLPRMV
1-70
YPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKH
70-140
FMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCV
140-210
DVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRL
210-280
TRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQA
280-350
VRNP
350-354
MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDHLQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP