You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PPP3CB
Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform

Protein Summary
Description
Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca(2+)-mediated signals (PubMed:19154138, PubMed:26794871). Dephosphorylates and activates transcription factor NFATC1 (PubMed:19154138). Dephosphorylates and inactivates transcription factor ELK1 (PubMed:19154138). Dephosphorylates DARPP32 (PubMed:19154138).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000360663
  • ENSP00000353881
  • ENSG00000107758
  • ENST00000394828
  • ENSP00000378305
  • ENST00000394829
  • ENSP00000378306

Symbol
  • CALNA2
  • CALNB
  • CNA2
  • CNA2
  • CALNB
  • CALNA2
  • PP2Bbeta
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
1
biological process
0.99
kinase perturbation
0.99
virus perturbation
0.92
interacting protein
0.82


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 34.19   (req: < 5)
Gene RIFs: 24   (req: <= 3)
Antibodies: 184   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 34.19   (req: >= 5)
Gene RIFs: 24   (req: > 3)
Antibodies: 184   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 37
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (70)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 24
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Axon guidance
Reactome
Beta-catenin independent WNT signaling
Reactome
C-type lectin receptors (CLRs)
Reactome
CLEC7A (Dectin-1) induces NFAT activation
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Axon guidance
Beta-catenin independent WNT signaling
C-type lectin receptors (CLRs)
CLEC7A (Dectin-1) induces NFAT activation
Gene Ontology Terms (45)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Non-traceable Author Statement (NAS)
UniProtKB
Protein-Protein Interactions (235)
1 – 10 of 235
RCAN1
Tbio
Novelty: 0.00396344
p_int: 0.999982418
p_ni: 0.000017582
Score: 0.846
Data Source: BioPlex,STRINGDB
PPP3R2
Tbio
Novelty: 0.0210854
p_int: 0.999958137
p_ni: 0.000041864
Score: 0.97
Data Source: BioPlex,STRINGDB
RCAN3
Tbio
Novelty: 0.16735029
p_int: 0.999887007
p_ni: 0.000112993
Score: 0.922
Data Source: BioPlex,STRINGDB
TMEM200A
Tbio
Novelty: 0.03088008
p_int: 0.999843512
p_ni: 0.000156488
Score: 0.552
Data Source: BioPlex,STRINGDB
TNS4
Tbio
Novelty: 0.05243227
p_int: 0.999666361
p_ni: 0.00033364
Data Source: BioPlex
PDHB
Tbio
Family: Enzyme
Novelty: 0.01625694
p_int: 0.999150471
p_ni: 0.000849529
Score: 0.631
Data Source: BioPlex,STRINGDB
RCAN2
Tbio
Novelty: 0.00795081
p_int: 0.998958804
p_ni: 0.001041196
Score: 0.848
Data Source: BioPlex,STRINGDB
DEFA1
Tbio
Novelty: 0.01616437
p_int: 0.998697544
p_ni: 0.001302456
Data Source: BioPlex
GSK3A
Tclin
Family: Kinase
Novelty: 0.01538406
p_int: 0.993212468
p_ni: 0.006787532
Score: 0.355
Data Source: BioPlex,STRINGDB
PPP3CC
Tbio
Family: Enzyme
Novelty: 0.04180044
p_int: 0.973471029
p_ni: 0.026528971
Score: 0.982
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  34.19

PubMed score by year
PubTator Score  20.46

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIA
1-70
LRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVL
70-140
YLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGG
140-210
LSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQN
210-280
NNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPY
280-350
WLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFS
350-420
VLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINE
420-490
RMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
490-524
MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ