You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
ALOX15
Arachidonate 15-lipoxygenase

Protein Summary
Description
Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids generating a spectrum of bioactive lipid mediators. Converts arachidonic acid into 12-hydroperoxyeicosatetraenoic acid/12-HPETE and 15-hydroperoxyeicosatetraenoic acid/15-HPETE. Also converts linoleic acid to 13-hydroperoxyoctadecadienoic acid. May also act on (12S)-hydroperoxyeicosatetraenoic acid/(12S)-HPETE to produce hepoxilin A3. Probably plays an important role in the immune and inflammatory responses. Through the oxygenation of membrane-bound phosphatidylethanolamine in macrophages may favor clearance of apoptotic cells during inflammation by resident macrophages and prevent an autoimmune response associated with the clearance of apoptotic cells by inflammatory monocytes. In parallel, may regulate actin polymerization which is crucial for several biological processes, including macrophage function. May also regulate macrophage function through r ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000293761
  • ENSP00000293761
  • ENSG00000161905
  • ENST00000570836
  • ENSP00000458832
  • ENST00000574640
  • ENSP00000460483

Symbol
  • LOG15
  • LOG15
  • 12-LOX
  • 15-LOX
  • 15-LOX-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.96
protein domain
0.92
biological term
0.91
molecular function
0.91
chemical
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 463.81   (req: < 5)
Gene RIFs: 150   (req: <= 3)
Antibodies: 302   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 463.81   (req: >= 5)
Gene RIFs: 150   (req: > 3)
Antibodies: 302   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 30
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 155
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
masoprocol
chemical structure image
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (34)
Arachidonic acid metabolism (R-HSA-2142753)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 21
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Arachidonic acid metabolism
Reactome
Biosynthesis of DHA-derived SPMs
Reactome
Biosynthesis of DPA-derived SPMs
Reactome
Biosynthesis of DPAn-3 SPMs
Reactome
Biosynthesis of DPAn-3-derived protectins and resolvins
Name
Explore in Pharos
Explore in Source
Arachidonic acid metabolism
Biosynthesis of DHA-derived SPMs
Biosynthesis of DPA-derived SPMs
Biosynthesis of DPAn-3 SPMs
Biosynthesis of DPAn-3-derived protectins and resolvins
Gene Ontology Terms (35)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (85)
1 – 10 of 85
DDX19B
Tbio
Family: Enzyme
Novelty: 0.05099873
p_int: 0.999795164
p_ni: 0.000204836
Score: 0.19
Data Source: BioPlex,STRINGDB
TIMM29
Tdark
Novelty: 0.67741935
p_int: 0.959908687
p_ni: 0.037997653
p_wrong: 0.002093659
Score: 0.214
Data Source: BioPlex,STRINGDB
IL4
Tbio
Novelty: 0.00010156
Score: 0.972
Data Source: STRINGDB
IL13
Tbio
Novelty: 0.00043714
Score: 0.965
Data Source: STRINGDB
PTGS2
Tclin
Family: Enzyme
Novelty: 0.00008134
Score: 0.959
Data Source: STRINGDB
PTGS1
Tclin
Family: Enzyme
Novelty: 0.00056169
Score: 0.958
Data Source: STRINGDB
CYP2B6
Tchem
Novelty: 0.00018723
Score: 0.932
Data Source: STRINGDB
CYP2J2
Tchem
Novelty: 0.00634057
Score: 0.929
Data Source: STRINGDB
CYP4F3
Tbio
Family: Enzyme
Novelty: 0.01901093
Score: 0.926
Data Source: STRINGDB
CYP2C9
Tchem
Novelty: 0.00054291
Score: 0.922
Data Source: STRINGDB
Publication Statistics
PubMed Score  463.81

PubMed score by year
PubTator Score  596.2

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHL
1-70
LKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYR
70-140
WGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCG
140-210
QSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSL
210-280
LDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSS
280-350
DFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMST
350-420
GGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVSLHYKTDVAVK
420-490
DDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCT
490-560
MRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREEL
560-630
AALDKEIEIRNAKLDMPYEYLRPSVVENSVAI
630-662
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI