You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
COX7C
Cytochrome c oxidase subunit 7C, mitochondrial

Protein Summary
Description
This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIc, which shares 87% and 85% amino acid sequence identity with mouse and bovine COX VIIc, respectively, and is found in all tissues. A pseudogene COX7CP1 has been found on chromosome 13. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000247655
  • ENSP00000247655
  • ENSG00000127184
  • ENST00000509578
  • ENSP00000425759
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.98
co-expressed gene
0.91
virus perturbation
0.85
kinase perturbation
0.76
transcription factor binding site profile
0.72


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.37   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 51   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.37   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 51   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (19)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
Metabolism
Reactome
RNA Polymerase II Transcription
Reactome
Respiratory electron transport
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Generic Transcription Pathway
Metabolism
RNA Polymerase II Transcription
Respiratory electron transport
Gene Ontology Terms (7)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (176)
1 – 10 of 176
COX6C
Tbio
Family: Enzyme
Novelty: 0.05809639
Score: 0.999
Data Source: STRINGDB
COX5A
Tbio
Family: Enzyme
Novelty: 0.00062551
Score: 0.999
Data Source: STRINGDB
COX5B
Tbio
Family: Enzyme
Novelty: 0.02465452
Score: 0.999
Data Source: STRINGDB
MT-CO2
Tchem
Family: Enzyme
Novelty: 0.0009314
Score: 0.999
Data Source: STRINGDB
UQCRQ
Tbio
Novelty: 0.06872273
Score: 0.999
Data Source: STRINGDB
COX6B1
Tbio
Family: Enzyme
Novelty: 0.03940517
Score: 0.998
Data Source: STRINGDB
COX6A1
Tbio
Family: Enzyme
Novelty: 0.08113947
Score: 0.997
Data Source: STRINGDB
COX4I1
Tbio
Family: Enzyme
Novelty: 0.00416656
Score: 0.996
Data Source: STRINGDB
COX7A2
Tbio
Family: Enzyme
Novelty: 0.05966072
Score: 0.995
Data Source: STRINGDB
COX7B
Tbio
Family: Enzyme
Novelty: 0.19457236
Score: 0.992
Data Source: STRINGDB
Publication Statistics
PubMed Score  10.37

PubMed score by year
PubTator Score  4.56

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT
1-70
MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT