You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
VEGFA
Vascular endothelial growth factor A

Protein Summary
Description
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity). This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for b ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000372077
  • ENSP00000361148
  • ENSG00000112715
  • ENST00000457104
  • ENSP00000409911
  • ENST00000518689
  • ENSP00000430829
  • ENST00000518824
  • ENSP00000430002
  • ENST00000520948
  • ENSP00000428321
  • ENST00000523125
  • ENSP00000429008
  • ENST00000523873
  • ENSP00000430479
  • ENST00000523950
  • ENSP00000429643
  • ENST00000611736
  • ENSP00000478570
  • ENST00000615393
  • ENSP00000478034
  • ENST00000617771
  • ENSP00000484284
  • ENST00000621747
  • ENSP00000483241
  • ENST00000640482
  • ENSP00000492800
  • ENST00000640499
  • ENSP00000492413
  • ENST00000640653
  • ENSP00000492199

Symbol
  • VEGF
  • VPF
  • VEGF
  • MVCD1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
1
chemical
1
disease
1
small molecule perturbation
0.97


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 20877.71   (req: < 5)
Gene RIFs: 4064   (req: <= 3)
Antibodies: 2331   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 20877.71   (req: >= 5)
Gene RIFs: 4064   (req: > 3)
Antibodies: 2331   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 121
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 32
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 5
Protein Data Bank (39)
1 – 5 of 39
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (95)
Cellular response to hypoxia (R-HSA-1234174)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 24
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cellular response to hypoxia
Reactome
Cellular responses to external stimuli
Reactome
Cellular responses to stress
Reactome
Cytokine Signaling in Immune system
Reactome
Gene expression (Transcription)
Name
Explore in Pharos
Explore in Source
Cellular response to hypoxia
Cellular responses to external stimuli
Cellular responses to stress
Cytokine Signaling in Immune system
Gene expression (Transcription)
Gene Ontology Terms (129)
Items per page:
10
1 – 10 of 16
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
MGI
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Protein-Protein Interactions (1040)
1 – 10 of 1040
FLT1
Tclin
Family: Kinase
Novelty: 0.00037168
p_int: 0.999999068
p_ni: 9.32e-7
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
VEGFB
Tclin
Novelty: 0.00363465
p_int: 0.999876188
p_ni: 9.61e-7
p_wrong: 0.000122851
Score: 0.958
Data Source: BioPlex,STRINGDB
ACTBL2
Tbio
Novelty: 0.35273907
p_int: 0.900643675
p_ni: 0.099356325
Data Source: BioPlex
KDR
Tclin
Family: Kinase
Novelty: 0.00019671
Score: 0.999
Data Source: Reactome,STRINGDB
NRP2
Tbio
Novelty: 0.00918546
Score: 0.998
Data Source: STRINGDB
HIF1A
Tchem
Family: TF
Novelty: 0.00031917
Score: 0.996
Data Source: STRINGDB
NRP1
Tchem
Novelty: 0.00183532
Score: 0.995
Data Source: STRINGDB
STAT3
Tchem
Family: TF
Novelty: 0.00013496
Score: 0.994
Data Source: STRINGDB
EGF
Tbio
Novelty: 0.00015623
Score: 0.993
Data Source: STRINGDB
IGF1
Tbio
Novelty: 0.00004544
Score: 0.993
Data Source: STRINGDB
Publication Statistics
PubMed Score  20877.71

PubMed score by year
PubTator Score  25351.76

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIE
1-70
YIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQE
70-140
KKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTD
140-210
SRCKARQLELNERTCRCDKPRR
210-232
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR