You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FOSL1
Fos-related antigen 1

Protein Summary
Description
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000312562
  • ENSP00000310170
  • ENSG00000175592
  • ENST00000448083
  • ENSP00000393302

Symbol
  • FRA1
  • FRA
  • FRA1
  • fra-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
1
gene perturbation
1
biological process
0.95
small molecule perturbation
0.93
chemical
0.87


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 260.34   (req: < 5)
Gene RIFs: 83   (req: <= 3)
Antibodies: 373   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 260.34   (req: >= 5)
Gene RIFs: 83   (req: > 3)
Antibodies: 373   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 29
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (23)
Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
KEGG
Human T-cell leukemia virus 1 infection
KEGG
IL-17 signaling pathway
KEGG
Wnt signaling pathway
KEGG
Osteoclast differentiation
Name
Explore in Pharos
Explore in Source
Human T-cell leukemia virus 1 infection
IL-17 signaling pathway
Wnt signaling pathway
Osteoclast differentiation
Gene Ontology Terms (34)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Sequence Alignment (ISA)
NTNU_SB
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (120)
1 – 10 of 120
JUNB
Tbio
Family: TF
Novelty: 0.01119828
Score: 0.995
Data Source: STRINGDB
JUND
Tbio
Family: TF
Novelty: 0.00337776
Score: 0.994
Data Source: STRINGDB
JUN
Tchem
Family: TF
Novelty: 0.00013623
Score: 0.993
Data Source: STRINGDB
EP300
Tchem
Family: Epigenetic
Novelty: 0.00060382
Score: 0.956
Data Source: STRINGDB
NFATC1
Tbio
Family: TF
Novelty: 0.0015406
Score: 0.932
Data Source: STRINGDB
SP1
Tbio
Family: TF
Novelty: 0.00093438
Score: 0.924
Data Source: STRINGDB
USF2
Tbio
Family: TF
Novelty: 0.0023959
Score: 0.924
Data Source: STRINGDB
TXLNG
Tbio
Novelty: 0.00830787
Score: 0.921
Data Source: STRINGDB
NFATC2
Tbio
Family: TF
Novelty: 0.00358612
Score: 0.921
Data Source: STRINGDB
FOS
Tbio
Family: TF
Novelty: 0.00007002
Score: 0.913
Data Source: STRINGDB
Publication Statistics
PubMed Score  260.34

PubMed score by year
PubTator Score  306.59

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTY
1-70
PQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKL
70-140
EDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVL
140-210
EPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL
210-271
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL