You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
FOLR1
Folate receptor alpha

Protein Summary
Description
Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release. Required for normal embryonic development and normal cell proliferation. The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. Mutations in this gene have been associated with neurodegeneration due to cerebral folate transport deficiency. Due to the presence of two promoters, multiple transcription start sites, and alternative ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000312293
  • ENSP00000308137
  • ENSG00000110195
  • ENST00000393676
  • ENSP00000377281
  • ENST00000393679
  • ENSP00000377284
  • ENST00000393681
  • ENSP00000377286

Symbol
  • FOLR
  • FBP
  • FOLR
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.82
transcription factor perturbation
0.8
disease perturbation
0.79
gene perturbation
0.77
small molecule perturbation
0.77


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 231.99   (req: < 5)
Gene RIFs: 90   (req: <= 3)
Antibodies: 432   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 231.99   (req: >= 5)
Gene RIFs: 90   (req: > 3)
Antibodies: 432   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 22
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 3
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (89)
Asparagine N-linked glycosylation (R-HSA-446203)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Asparagine N-linked glycosylation
Reactome
COPI-mediated anterograde transport
Reactome
COPII-mediated vesicle transport
Reactome
Cargo concentration in the ER
Reactome
ER to Golgi Anterograde Transport
Name
Explore in Pharos
Explore in Source
Asparagine N-linked glycosylation
COPI-mediated anterograde transport
COPII-mediated vesicle transport
Cargo concentration in the ER
ER to Golgi Anterograde Transport
Protein-Protein Interactions (168)
1 – 10 of 168
ACTR10
Tbio
Novelty: 0.17285319
Score: 0.926
Data Source: STRINGDB
LMAN1
Tbio
Novelty: 0.00340578
Score: 0.921
Data Source: STRINGDB
SPTB
Tbio
Novelty: 0.0031907
Score: 0.918
Data Source: STRINGDB
TMED10
Tbio
Novelty: 0.0307377
Score: 0.913
Data Source: Reactome,STRINGDB
DCTN6
Tdark
Novelty: 0.93301435
Score: 0.913
Data Source: STRINGDB
ARFGAP2
Tbio
Family: Enzyme
Novelty: 0.07850068
Score: 0.91
Data Source: STRINGDB
CNIH1
Tbio
Novelty: 0.13636364
Score: 0.909
Data Source: STRINGDB
CAPZA1
Tbio
Novelty: 0.04371834
Score: 0.908
Data Source: STRINGDB
INS
Tbio
Novelty: 0.00000614
Score: 0.908
Data Source: STRINGDB
SPTBN4
Tbio
Novelty: 0.02643805
Score: 0.907
Data Source: STRINGDB
Publication Statistics
PubMed Score  231.99

PubMed score by year
PubTator Score  287.84

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNT
1-70
SQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCE
70-140
QWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCI
140-210
QMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
210-257
MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS