You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LIF
Leukemia inhibitory factor

Protein Summary
Description
LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes. The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000249075
  • ENSP00000249075
  • ENSG00000128342
  • ENST00000403987
  • ENSP00000384450

Symbol
  • HILDA
  • CDF
  • DIA
  • HILDA
  • MLPLI
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
0.93
gene perturbation
0.93
PubMedID
0.93
phenotype
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 572.72   (req: < 5)
Gene RIFs: 155   (req: <= 3)
Antibodies: 546   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 572.72   (req: >= 5)
Gene RIFs: 155   (req: > 3)
Antibodies: 546   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 40
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (29)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
IL-6-type cytokine receptor ligand interactions
Reactome
Immune System
Reactome
Interleukin-10 signaling
Reactome
Interleukin-4 and Interleukin-13 signaling
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
IL-6-type cytokine receptor ligand interactions
Immune System
Interleukin-10 signaling
Interleukin-4 and Interleukin-13 signaling
Protein-Protein Interactions (200)
1 – 10 of 200
IL6ST
Tclin
Novelty: 0.01731532
Score: 0.993
Data Source: Reactome,STRINGDB
LIFR
Tbio
Novelty: 0.00477162
Score: 0.988
Data Source: Reactome,STRINGDB
CTF1
Tbio
Novelty: 0.00467885
Score: 0.979
Data Source: STRINGDB
STAT3
Tchem
Family: TF
Novelty: 0.00013496
Score: 0.973
Data Source: STRINGDB
IGF1
Tbio
Novelty: 0.00004544
Score: 0.953
Data Source: STRINGDB
IL10
Tbio
Novelty: 0.00007359
Score: 0.952
Data Source: STRINGDB
JAK2
Tclin
Family: Kinase
Novelty: 0.00028252
Score: 0.951
Data Source: Reactome,STRINGDB
JAK1
Tclin
Family: Kinase
Novelty: 0.00136831
Score: 0.95
Data Source: Reactome,STRINGDB
TYK2
Tclin
Family: Kinase
Novelty: 0.00331363
Score: 0.943
Data Source: STRINGDB
HBEGF
Tbio
Novelty: 0.00087306
Score: 0.943
Data Source: STRINGDB
Publication Statistics
PubMed Score  572.72

PubMed score by year
PubTator Score  2484.33

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQ
1-70
GEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNAT
70-140
ADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
140-202
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF