You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
HSP90B1
Endoplasmin

Protein Summary
Description
Molecular chaperone that functions in the processing and transport of secreted proteins. When associated with CNPY3, required for proper folding of Toll-like receptors (By similarity). Functions in endoplasmic reticulum associated degradation (ERAD). Has ATPase activity. This gene encodes a member of a family of adenosine triphosphate(ATP)-metabolizing molecular chaperones with roles in stabilizing and folding other proteins. The encoded protein is localized to melanosomes and the endoplasmic reticulum. Expression of this protein is associated with a variety of pathogenic states, including tumor formation. There is a microRNA gene located within the 5' exon of this gene. There are pseudogenes for this gene on chromosomes 1 and 15. [provided by RefSeq, Aug 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000299767
  • ENSP00000299767
  • ENSG00000166598

Symbol
  • GRP94
  • TRA1
  • ECGP
  • GP96
  • TRA1
  • GRP94
  • HEL35
  • HEL-S-125m
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
1
transcription factor perturbation
0.98
molecular function
0.97
virus perturbation
0.94
biological process
0.93


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 656.4   (req: < 5)
Gene RIFs: 116   (req: <= 3)
Antibodies: 1239   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 656.4   (req: >= 5)
Gene RIFs: 116   (req: > 3)
Antibodies: 1239   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 23
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 59
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (32)
ATF6 (ATF6-alpha) activates chaperone genes (R-HSA-381183)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 17
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
ATF6 (ATF6-alpha) activates chaperone genes
Reactome
ATF6 (ATF6-alpha) activates chaperones
Reactome
Binding and Uptake of Ligands by Scavenger Receptors
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Name
Explore in Pharos
Explore in Source
ATF6 (ATF6-alpha) activates chaperone genes
ATF6 (ATF6-alpha) activates chaperones
Binding and Uptake of Ligands by Scavenger Receptors
Cytokine Signaling in Immune system
Immune System
Gene Ontology Terms (40)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (420)
1 – 10 of 420
OS9
Tbio
Novelty: 0.01598375
p_int: 0.96153235
p_ni: 0.03846765
Score: 0.969
Data Source: BioPlex,STRINGDB
LYZL2
Tdark
Family: Enzyme
Novelty: 1.38461538
p_int: 0.757309725
p_ni: 0.242690275
Score: 0.239
Data Source: BioPlex,STRINGDB
HSPA5
Tchem
Novelty: 0.00051387
Score: 0.999
Data Source: STRINGDB
CALR
Tbio
Novelty: 0.00058349
Score: 0.999
Data Source: STRINGDB
P4HB
Tbio
Family: Enzyme
Novelty: 0.00117072
Score: 0.998
Data Source: STRINGDB
PDIA6
Tchem
Family: Enzyme
Novelty: 0.02339159
Score: 0.997
Data Source: STRINGDB
DNAJC3
Tbio
Novelty: 0.03555633
Score: 0.995
Data Source: STRINGDB
HYOU1
Tbio
Novelty: 0.00973194
Score: 0.995
Data Source: STRINGDB
PRKCSH
Tbio
Family: Enzyme
Novelty: 0.00609928
Score: 0.994
Data Source: STRINGDB
PDIA4
Tbio
Family: Enzyme
Novelty: 0.0202442
Score: 0.991
Data Source: STRINGDB
Publication Statistics
PubMed Score  656.40

PubMed score by year
PubTator Score  415.91

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELR
1-70
EKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDK
70-140
EKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVI
140-210
VTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIY
210-280
VWSSKTETVEEPMEEEEAAKEEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEV
280-350
EEDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD
350-420
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKYNDTFWKEFGT
420-490
NIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLK
490-560
KGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREAVEKEFEPLLNWMKDKALKDK
560-630
IEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRR
630-700
IKEDEDDKTVLDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETAEDT
700-770
TEDTEQDEDEEMDVGTDEEEETAKESTAEKDEL
770-803
MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAKEEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDDFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKYNDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETAEDTTEDTEQDEDEEMDVGTDEEEETAKESTAEKDEL