You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
HGF
Hepatocyte growth factor

Protein Summary
Description
Potent mitogen for mature parenchymal hepatocyte cells, seems to be a hepatotrophic factor, and acts as a growth factor for a broad spectrum of tissues and cell types. Activating ligand for the receptor tyrosine kinase MET by binding to it and promoting its dimerization. This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate alpha and beta chains, which form the mature heterodimer. This protein is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. This protein also plays a role in angiogenesis, tumorogenesis, and tissue regeneration. Although the encoded protein is a member of the peptidase S1 family of serine proteases, it lacks peptidase activity. Mutations in t ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000222390
  • ENSP00000222390
  • ENSG00000019991
  • ENST00000423064
  • ENSP00000413829
  • ENST00000444829
  • ENSP00000389854
  • ENST00000453411
  • ENSP00000408270
  • ENST00000457544
  • ENSP00000391238
  • ENST00000644543
  • ENSP00000494899

Symbol
  • HPTA
  • SF
  • HGFB
  • HPTA
  • F-TCF
  • DFNB39
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
1
protein domain
1
PubMedID
1
kinase perturbation
0.99


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2536.52   (req: < 5)
Gene RIFs: 635   (req: <= 3)
Antibodies: 919   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2536.52   (req: >= 5)
Gene RIFs: 635   (req: > 3)
Antibodies: 919   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 46
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 4
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (28)
1 – 5 of 28
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (108)
Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 36
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Constitutive Signaling by Aberrant PI3K in Cancer
Reactome
Cytokine Signaling in Immune system
Reactome
Disease
Reactome
Diseases of signal transduction
Reactome
FLT3 Signaling
Name
Explore in Pharos
Explore in Source
Constitutive Signaling by Aberrant PI3K in Cancer
Cytokine Signaling in Immune system
Disease
Diseases of signal transduction
FLT3 Signaling
Gene Ontology Terms (50)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Non-traceable Author Statement (NAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (458)
1 – 10 of 458
FKBP7
Tbio
Family: Enzyme
Novelty: 0.00592035
p_int: 0.764246759
p_ni: 0.235753241
Score: 0.538
Data Source: BioPlex,STRINGDB
MET
Tclin
Family: Kinase
Novelty: 0.00040613
Score: 0.999
Data Source: Reactome,STRINGDB
VEGFA
Tclin
Novelty: 0.00004909
Score: 0.992
Data Source: STRINGDB
FN1
Tchem
Novelty: 0.0000437
Score: 0.984
Data Source: STRINGDB
EGF
Tbio
Novelty: 0.00015623
Score: 0.984
Data Source: STRINGDB
CDH1
Tbio
Novelty: 0.0001303
Score: 0.98
Data Source: STRINGDB
ALB
Tchem
Novelty: 0.0000092
Score: 0.979
Data Source: STRINGDB
IGF1
Tbio
Novelty: 0.00004544
Score: 0.978
Data Source: STRINGDB
SRC
Tclin
Family: Kinase
Novelty: 0.00009742
Score: 0.977
Data Source: Reactome,STRINGDB
STAT3
Tchem
Family: TF
Novelty: 0.00013496
Score: 0.977
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  2536.52

PubMed score by year
PubTator Score  2837.74

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQC
1-70
ANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTV
70-140
SITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVE
140-210
CMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRW
210-280
EYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLR
280-350
ENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME
350-420
DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKT
420-490
KQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEK
490-560
CKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLR
560-630
VAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIP
630-700
NRPGIFVRVAYYAKWIHKIILTYKVPQS
700-728
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS