HSD17B1
Estradiol 17-beta-dehydrogenase 1
Protein Classes
Protein Summary
Favors the reduction of estrogens and androgens. Also has 20-alpha-HSD activity. Uses preferentially NADH. This gene encodes a member of the 17beta-hydroxysteroid dehydrogenase family of short-chain dehydrogenases/reductases. It has a dual function in estrogen activation and androgen inactivation and plays a major role in establishing the estrogen E2 concentration gradient between serum and peripheral tissues. The encoded protein catalyzes the last step in estrogen activation, using NADPH to convert estrogens E1 and E2 and androgens like 4-androstenedione, to testosterone. It has an N-terminal short-chain dehydrogenase domain with a cofactor binding site, and a narrow, hydrophobic C-terminal domain with a steroid substrate binding site. This gene is expressed primarily in the placenta and ovarian granulosa cells, and to a lesser extent, in the endometrium, adipose tissue, and prostate. Polymorphisms in this gene have been linked to breast and prostate cancer. A pseudogene of this gene ...more
- ENST00000585807
- ENSP00000466799
- ENSG00000108786
- E17KSR
- EDH17B1
- EDH17B2
- EDHB17
- SDR28C1
- E2DH
- HSD17
- EDHB17
- EDH17B2
- SDR28C1
- 17-beta-HSD
- 20-alpha-HSD
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
|---|---|---|---|
phenotype | 0.85 | ||
protein domain | 0.73 | ||
biological term | 0.69 | ||
gene perturbation | 0.69 | ||
PubMedID | 0.68 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 287.95 (req: < 5)
Gene RIFs: 74 (req: <= 3)
Antibodies: 265 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 287.95 (req: >= 5)
Gene RIFs: 74 (req: > 3)
Antibodies: 265 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 8
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligands: 269
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
Active Ligands (269)
1 – 10 of 269
Protein Data Bank (23)
1 – 5 of 23
PDB Structure Id | Ligand | Method | Resolution (Å) | M.W. (kDa) | Pub Year | Title |
|---|
PDB Structure Id | M.W. | Resolution | Pub Year |
|---|
Pathways (57)
Reactome (11)
KEGG (3)
PathwayCommons (1)
UniProt (1)
WikiPathways (41)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 11
Data Source | Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|---|
Reactome | Estrogen biosynthesis | ||||
Reactome | G alpha (i) signalling events | ||||
Reactome | GPCR downstream signalling | ||||
Reactome | Metabolism | ||||
Reactome | Metabolism of lipids | ||||
Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|
Estrogen biosynthesis | ||||
G alpha (i) signalling events | ||||
GPCR downstream signalling | ||||
Metabolism | ||||
Metabolism of lipids | ||||
Gene Ontology Terms (10)
Functions (5)
Components (2)
Processes (3)
Items per page:
10
1 – 5 of 5
GO Term | Evidence | Assigned by | ||
|---|---|---|---|---|
Inferred from Direct Assay (IDA) | CAFA | |||
Inferred from Direct Assay (IDA) | CAFA | |||
Inferred from Direct Assay (IDA) | CAFA | |||
Inferred from Mutant Phenotype (IMP) | CAFA | |||
Traceable Author Statement (TAS) | ProtInc | |||
Protein-Protein Interactions (95)
1 – 10 of 95
EMB
Novelty: 0.00148583
p_int: 0.997334253
p_ni: 0.002489045
p_wrong: 0.000176702
Data Source: BioPlex
NOCT
Novelty: 0.01352299
p_int: 0.966310403
p_ni: 0.033672443
p_wrong: 0.000017154
Data Source: BioPlex
HMOX1
Family: Enzyme
Novelty: 0.00016148
p_int: 0.954601052
p_ni: 0.045398721
p_wrong: 2.26e-7
Data Source: BioPlex
RNASEL
Family: Kinase
Novelty: 0.00186243
p_int: 0.952880216
p_ni: 0.046870586
p_wrong: 0.000249198
Data Source: BioPlex
MPZL1
Novelty: 0.03869016
p_int: 0.938204852
p_ni: 0.061653883
p_wrong: 0.000141265
Data Source: BioPlex
PDLIM5
Novelty: 0.00263369
p_int: 0.923610693
p_ni: 0.076389303
p_wrong: 3e-9
Data Source: BioPlex
RBM10
Novelty: 0.00665073
p_int: 0.900758183
p_ni: 0.099241817
Data Source: BioPlex
RAD21
Novelty: 0.00373367
p_int: 0.882986653
p_ni: 0.117012489
p_wrong: 8.58e-7
Data Source: BioPlex
MCU
Family: IC
Novelty: 0.00168833
p_int: 0.874080362
p_ni: 0.125919638
Data Source: BioPlex
ATP2B2
Family: Transporter
Novelty: 0.00724828
p_int: 0.866793856
p_ni: 0.133206144
Data Source: BioPlex
Publication Statistics
PubMed Score 287.95
PubMed score by year
PubTator Score 297.17
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSLETLQLDVRDS
1-70
KSVAAARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLV
70-140
TGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDI
140-210
HTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAM
210-280
HREVFGDVPAKAEAGAEAGGGAGPGAEDEAGRGAVGDPELGDPPAAPQ
280-328
MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSLETLQLDVRDSKSVAAARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGGGAGPGAEDEAGRGAVGDPELGDPPAAPQ
Find similar targets by: