You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HLA-E
HLA class I histocompatibility antigen, alpha chain E

Protein Summary
Description
Non-classical major histocompatibility class Ib molecule involved in immune self-nonself discrimination. In complex with B2M/beta-2-microglobulin binds nonamer self-peptides derived from the signal sequence of classical MHC class Ia molecules (VL9 peptides) (PubMed:9754572, PubMed:18083576, PubMed:18339401). Peptide-bound HLA-E-B2M heterotrimeric complex primarily functions as a ligand for natural killer (NK) cell inhibitory receptor KLRD1-KLRC1, enabling NK cells to monitor the expression of other MHC class I molecules in healthy cells and to tolerate self (PubMed:9754572, PubMed:9486650, PubMed:17179229, PubMed:18083576). Upon cellular stress, preferentially binds signal sequence-derived peptides from stress-induced chaperones and is no longer recognized by NK cell inhibitory receptor KLRD1-KLRC1, resulting in impaired protection from NK cells (PubMed:12461076). Binds signal sequence-derived peptides from non-classical MHC class Ib HLA-G molecules and acts as a ligand for NK cell act ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000383597
  • ENSP00000373091
  • ENSG00000206493
  • ENST00000415289
  • ENSP00000409910
  • ENSG00000229252
  • ENST00000415649
  • ENSP00000390707
  • ENSG00000233904
  • ENST00000427936
  • ENSP00000397420
  • ENSG00000230254

Symbol
  • HLA-6.2
  • HLAE
  • QA1
  • HLA-6.2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
1
protein domain
0.97
biological process
0.96
biological term
0.88
disease
0.82


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 480.47   (req: < 5)
Gene RIFs: 149   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 480.47   (req: >= 5)
Gene RIFs: 149   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 31
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (11)
1 – 5 of 11
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (77)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Antigen Presentation: Folding, assembly and peptide loading of class I MHC
Reactome
Antigen processing-Cross presentation
Reactome
Class I MHC mediated antigen processing & presentation
Reactome
Cytokine Signaling in Immune system
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Antigen Presentation: Folding, assembly and peptide loading of class I MHC
Antigen processing-Cross presentation
Class I MHC mediated antigen processing & presentation
Cytokine Signaling in Immune system
Gene Ontology Terms (42)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Protein-Protein Interactions (327)
1 – 10 of 327
HLA-B
Tbio
Novelty: 0.01289492
p_int: 0.999999626
p_ni: 3.74e-7
Score: 0.966
Data Source: BioPlex,STRINGDB
ECEL1
Tbio
Family: Enzyme
Novelty: 0.00885518
p_int: 0.999670812
p_ni: 0.000329187
p_wrong: 1e-9
Data Source: BioPlex
HLA-A
Tbio
Novelty: 0.00378961
p_int: 0.999658149
p_ni: 0.000341851
Score: 0.936
Data Source: BioPlex,STRINGDB
CNTNAP3
Tdark
Novelty: 0.28305555
p_int: 0.998866598
p_ni: 0.001133402
Data Source: BioPlex
HLA-C
Tbio
Novelty: 0.01022087
p_int: 0.99533142
p_ni: 0.00466858
Score: 0.967
Data Source: BioPlex,STRINGDB
FCGRT
Tchem
Novelty: 0.0014463
p_int: 0.99140209
p_ni: 0.00859791
Score: 0.461
Data Source: BioPlex,STRINGDB
HLA-G
Tbio
Novelty: 0.00082058
p_int: 0.988282919
p_ni: 0.011717081
Score: 0.969
Data Source: BioPlex,STRINGDB
ITGA6
Tbio
Novelty: 0.00351957
p_int: 0.986269973
p_ni: 0.013730027
p_wrong: 1e-9
Data Source: BioPlex
ASPH
Tbio
Family: Enzyme
Novelty: 0.00189873
p_int: 0.976505747
p_ni: 0.023494253
Data Source: BioPlex
EPHB4
Tchem
Family: Kinase
Novelty: 0.00320693
p_int: 0.975819259
p_ni: 0.024180739
p_wrong: 2e-9
Data Source: BioPlex
Publication Statistics
PubMed Score  480.47

PubMed score by year
PubTator Score  356.4

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRA
1-70
PWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYD
70-140
GKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHV
140-210
THHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTC
210-280
HVQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGSYSKAEWSDSA
280-350
QGSESHSL
350-358
MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGSYSKAEWSDSAQGSESHSL