You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
EEF2
Elongation factor 2

Protein Summary
Description
Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome. This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000309311
  • ENSP00000307940
  • ENSG00000167658

Symbol
  • EF2
  • EF2
  • EF-2
  • EEF-2
  • SCA26
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
interacting protein
1
protein domain
1
kinase perturbation
0.98
molecular function
0.98


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1059.35   (req: < 5)
Gene RIFs: 28   (req: <= 3)
Antibodies: 493   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1059.35   (req: >= 5)
Gene RIFs: 28   (req: > 3)
Antibodies: 493   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 26
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
M5717
chemical structure image
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (21)
Disease (R-HSA-1643685)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Disease
Reactome
Eukaryotic Translation Elongation
Reactome
Gamma carboxylation, hypusine formation and arylsulfatase activation
Reactome
Immune System
Reactome
Infectious disease
Name
Explore in Pharos
Explore in Source
Disease
Eukaryotic Translation Elongation
Gamma carboxylation, hypusine formation and arylsulfatase activation
Immune System
Infectious disease
Gene Ontology Terms (40)
Items per page:
10
1 – 10 of 10
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
BHF-UCL
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (631)
1 – 10 of 631
FBXO9
Tbio
Novelty: 0.45236398
p_int: 0.992246252
p_ni: 0.007753748
Score: 0.563
Data Source: BioPlex,STRINGDB
DEFA1
Tbio
Novelty: 0.01616437
p_int: 0.991584763
p_ni: 0.008415237
Data Source: BioPlex
EEF2KMT
Tdark
Family: Enzyme
Novelty: 0.39473684
p_int: 0.894189881
p_ni: 0.105810119
Score: 0.986
Data Source: BioPlex,Reactome,STRINGDB
SLC25A48
Tdark
Family: Transporter
Novelty: 2.57142857
p_int: 0.764772671
p_ni: 0.235227329
Score: 0.267
Data Source: BioPlex,STRINGDB
RPL6
Tbio
Novelty: 0.02335748
Score: 0.999
Data Source: STRINGDB
RPL26
Tbio
Novelty: 0.02081491
Score: 0.999
Data Source: STRINGDB
RPL7
Tbio
Novelty: 0.00758123
Score: 0.999
Data Source: STRINGDB
RPL18A
Tbio
Novelty: 0.05603159
Score: 0.999
Data Source: STRINGDB
RPL17
Tbio
Novelty: 0.06372809
Score: 0.999
Data Source: STRINGDB
RPL10A
Tbio
Novelty: 0.02288439
Score: 0.999
Data Source: STRINGDB
Publication Statistics
PubMed Score  1059.35

PubMed score by year
PubTator Score  452.5

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITI
1-70
KSTAISLFYELSENDLNFIKQSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTE
70-140
TVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQRIVENVNVIISTYGEGESGPMGNIMIDPVLG
140-210
TVGFGSGLHGWAFTLKQFAEMYVAKFAAKGEGQLGPAERAKKVEDMMKKLWGDRYFDPANGKFSKSATSP
210-280
EGKKLPRTFCQLILDPIFKVFDAIMNFKKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDAL
280-350
LQMITIHLPSPVTAQKYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGL
350-420
VSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEH
420-490
AHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKD
490-560
LEEDHACIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKGEVSARQELKQ
560-630
RARYLAEKYEWDVAEARKIWCFGPDGTGPNILTDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRGV
630-700
RFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHV
700-770
FEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRK
770-840
RKGLKEGIPALDNFLDKL
840-858
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSENDLNFIKQSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQRIVENVNVIISTYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKGEGQLGPAERAKKVEDMMKKLWGDRYFDPANGKFSKSATSPEGKKLPRTFCQLILDPIFKVFDAIMNFKKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPSPVTAQKYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGLVSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVAEARKIWCFGPDGTGPNILTDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRKRKGLKEGIPALDNFLDKL