You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CYP4B1
Cytochrome P450 4B1

Protein Summary
Description
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. In rodents, the homologous protein has been shown to metabolize certain carcinogens; however, the specific function of the human protein has not been determined. Multiple transcript variants have been found for this gene. [provided by RefSeq, Jan 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000271153
  • ENSP00000271153
  • ENSG00000142973
  • ENST00000371923
  • ENSP00000360991

Symbol
  • CYPIVB1
  • P-450HP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.9
pathway
0.78
molecular function
0.7
kinase perturbation
0.66
small molecule perturbation
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 71.57   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 146   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 71.57   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 146   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (15)
Arachidonic acid metabolism (R-HSA-2142753)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Arachidonic acid metabolism
Reactome
Biological oxidations
Reactome
Cytochrome P450 - arranged by substrate type
Reactome
Eicosanoids
Reactome
Fatty acid metabolism
Name
Explore in Pharos
Explore in Source
Arachidonic acid metabolism
Biological oxidations
Cytochrome P450 - arranged by substrate type
Eicosanoids
Fatty acid metabolism
Gene Ontology Terms (12)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (39)
1 – 10 of 39
PKLR
Tbio
Family: Kinase
Novelty: 0.00411221
p_int: 0.998874876
p_ni: 0.001125123
p_wrong: 1e-9
Score: 0.699
Data Source: BioPlex,STRINGDB
PPIG
Tchem
Family: Enzyme
Novelty: 0.00019536
Score: 0.597
Data Source: STRINGDB
POR
Tbio
Family: Enzyme
Novelty: 0.00165447
Score: 0.595
Data Source: STRINGDB
CYP20A1
Tdark
Novelty: 0.15980124
Score: 0.499
Data Source: STRINGDB
TRARG1
Tbio
Novelty: 0.00245775
Score: 0.478
Data Source: STRINGDB
FMO1
Tbio
Family: Enzyme
Novelty: 0.03152164
Score: 0.476
Data Source: STRINGDB
VNN2
Tbio
Novelty: 0.02727863
Score: 0.476
Data Source: STRINGDB
FMO3
Tbio
Family: Enzyme
Novelty: 0.0062911
Score: 0.475
Data Source: STRINGDB
SLC37A1
Tbio
Family: Transporter
Novelty: 0.20022247
Score: 0.472
Data Source: STRINGDB
CYP2F1
Tbio
Novelty: 0.02652924
Score: 0.465
Data Source: STRINGDB
Publication Statistics
PubMed Score  71.57

PubMed score by year
PubTator Score  32.98

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVPSFLSLSFSSLGLWASGLILVLGFLKLIHLLLRRQTLAKAMDKFPGPPTHWLFGHALEIQETGSLDKV
1-70
VSWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQWIGRGLLVLEGPKWLQHRKL
70-140
LTPGFHYDVLKPYVAVFTESTRIMLDKWEEKAREGKSFDIFCDVGHMALNTLMKCTFGRGDTGLGHRDSS
140-210
YYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRKKIQNR
210-280
RHLDFLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILG
280-350
DQDFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVWP
350-420
DPEVFDSLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKMPQL
420-490
VLRSKNGFHLHLKPLGPGSGK
490-511
MVPSFLSLSFSSLGLWASGLILVLGFLKLIHLLLRRQTLAKAMDKFPGPPTHWLFGHALEIQETGSLDKVVSWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQWIGRGLLVLEGPKWLQHRKLLTPGFHYDVLKPYVAVFTESTRIMLDKWEEKAREGKSFDIFCDVGHMALNTLMKCTFGRGDTGLGHRDSSYYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRKKIQNRRHLDFLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILGDQDFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVWPDPEVFDSLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKMPQLVLRSKNGFHLHLKPLGPGSGK