You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LAMP2
Lysosome-associated membrane glycoprotein 2

Protein Summary
Description
Plays an important role in chaperone-mediated autophagy, a process that mediates lysosomal degradation of proteins in response to various stresses and as part of the normal turnover of proteins with a long biological half-live (PubMed:8662539, PubMed:11082038, PubMed:18644871, PubMed:24880125, PubMed:27628032). Functions by binding target proteins, such as GAPDH and MLLT11, and targeting them for lysosomal degradation (PubMed:8662539, PubMed:11082038, PubMed:18644871, PubMed:24880125). Plays a role in lysosomal protein degradation in response to starvation (By similarity). Required for the fusion of autophagosomes with lysosomes during autophagy (PubMed:27628032). Cells that lack LAMP2 express normal levels of VAMP8, but fail to accumulate STX17 on autophagosomes, which is the most likely explanation for the lack of fusion between autophagosomes and lysosomes (PubMed:27628032). Required for normal degradation of the contents of autophagosomes (PubMed:27628032). Required for efficient M ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000200639
  • ENSP00000200639
  • ENSG00000005893
  • ENST00000371335
  • ENSP00000360386
  • ENST00000434600
  • ENSP00000408411

Symbol
  • LAMPB
  • CD107b
  • LAMP-2
  • LGP-96
  • LGP110
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
kinase perturbation
1
transcription factor perturbation
1
virus perturbation
0.98
interacting protein
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 402.36   (req: < 5)
Gene RIFs: 78   (req: <= 3)
Antibodies: 1199   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 402.36   (req: >= 5)
Gene RIFs: 78   (req: > 3)
Antibodies: 1199   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (75)
Autophagy (R-HSA-9612973)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Autophagy
Reactome
Chaperone Mediated Autophagy
Reactome
Hemostasis
Reactome
Immune System
Reactome
Innate Immune System
Name
Explore in Pharos
Explore in Source
Autophagy
Chaperone Mediated Autophagy
Hemostasis
Immune System
Innate Immune System
Gene Ontology Terms (35)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (262)
1 – 10 of 262
BRF2
Tbio
Novelty: 0.35928144
p_int: 0.999999033
p_ni: 9.67e-7
Score: 0.185
Data Source: BioPlex,STRINGDB
GTPBP8
Tdark
Novelty: 6.51162791
p_int: 0.999791869
p_ni: 0.000208131
Data Source: BioPlex
SFXN5
Tdark
Novelty: 0.44295302
p_int: 0.999752822
p_ni: 0.000247178
Data Source: BioPlex
MTG2
Tbio
Family: Enzyme
Novelty: 0.25862069
p_int: 0.999523716
p_ni: 0.000476212
p_wrong: 7.2e-8
Data Source: BioPlex
CDC6
Tbio
Novelty: 0.00287878
p_int: 0.999480976
p_ni: 0.000519024
Data Source: BioPlex
NEK6
Tchem
Family: Kinase
Novelty: 0.02539529
p_int: 0.999295661
p_ni: 0.000703556
p_wrong: 7.83e-7
Data Source: BioPlex
STK39
Tbio
Family: Kinase
Novelty: 0.0065849
p_int: 0.998383272
p_ni: 0.001616728
Data Source: BioPlex
TAMM41
Tbio
Family: Enzyme
Novelty: 0.08219178
p_int: 0.998000823
p_ni: 0.001925837
p_wrong: 0.00007334
Data Source: BioPlex
CYP2S1
Tbio
Novelty: 0.04038753
p_int: 0.997785409
p_ni: 0.002214591
Data Source: BioPlex
GUF1
Tbio
Novelty: 0.00666297
p_int: 0.997500616
p_ni: 0.002206477
p_wrong: 0.000292907
Data Source: BioPlex
Publication Statistics
PubMed Score  402.36

PubMed score by year
PubTator Score  313.28

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHG
1-70
TVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDEL
70-140
LAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTT
140-210
TPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIK
210-280
YLDFVFAVKNENRFYLKEVNISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDL
280-350
RVQPFNVTQGKYSTAQDCSADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF
350-410
MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLDFVFAVKNENRFYLKEVNISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTAQDCSADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF