You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HOXD8
Homeobox protein Hox-D8

Protein Summary
Description
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. In addition to effects during embryogenesis, this particular gene may also play a role in adult urogenital tract function. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Dec 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000313173
  • ENSP00000315949
  • ENSG00000175879
  • ENST00000450510
  • ENSP00000409026

Symbol
  • HOX4E
  • HOX4
  • HOX4E
  • HOX5.4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.73
tissue sample
0.71
biological process
0.69
PubMedID
0.68
cell type or tissue
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 14.22   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 239   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 14.22   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 239   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (22)
1 – 10 of 22
HOXD9
Tbio
Family: TF
Novelty: 0.02722706
Score: 0.702
Data Source: STRINGDB
HOXD3
Tbio
Family: TF
Novelty: 0.02841766
Score: 0.596
Data Source: STRINGDB
HOXD10
Tbio
Family: TF
Novelty: 0.0144966
Score: 0.562
Data Source: STRINGDB
HOXD4
Tbio
Family: TF
Novelty: 0.01929267
Score: 0.52
Data Source: STRINGDB
HOXC9
Tbio
Family: TF
Novelty: 0.03402121
Score: 0.513
Data Source: STRINGDB
HOXA11
Tbio
Family: TF
Novelty: 0.00980634
Score: 0.497
Data Source: STRINGDB
TBX15
Tbio
Family: TF
Novelty: 0.04244654
Score: 0.494
Data Source: STRINGDB
HOXC10
Tbio
Family: TF
Novelty: 0.04638948
Score: 0.485
Data Source: STRINGDB
HOXD13
Tbio
Family: TF
Novelty: 0.00497439
Score: 0.473
Data Source: STRINGDB
HOXD11
Tbio
Family: TF
Novelty: 0.02536341
Score: 0.469
Data Source: STRINGDB
Publication Statistics
PubMed Score  14.22

PubMed score by year
PubTator Score  15.19

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSSYFVNPLYSKYKAAAAAAAAAGEAINPTYYDCHFAPEVGGRHAAAAAALQLYGNSAAGFPHAPPQAHA
1-70
HPHPSPPPSGTGCGGREGRGQEYFHPGGGSPAAAYQAAPPPPPHPPPPPPPPPCGGIACHGEPAKFYGYD
70-140
NLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMRPQAAPGRRRGRQTYSRFQTL
140-210
ELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKENNKDKFPVSRQEVKDGETKKEAQEL
210-280
EEDRAEGLTN
280-290
MSSYFVNPLYSKYKAAAAAAAAAGEAINPTYYDCHFAPEVGGRHAAAAAALQLYGNSAAGFPHAPPQAHAHPHPSPPPSGTGCGGREGRGQEYFHPGGGSPAAAYQAAPPPPPHPPPPPPPPPCGGIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMRPQAAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKENNKDKFPVSRQEVKDGETKKEAQELEEDRAEGLTN