You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GP1BB
Platelet glycoprotein Ib beta chain

Protein Summary
Description
Gp-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to von Willebrand factor, which is already bound to the subendothelium. Platelet glycoprotein Ib (GPIb) is a heterodimeric transmembrane protein consisting of a disulfide-linked 140 kD alpha chain and 22 kD beta chain. It is part of the GPIb-V-IX system that constitutes the receptor for von Willebrand factor (VWF), and mediates platelet adhesion in the arterial circulation. GPIb alpha chain provides the VWF binding site, and GPIb beta contributes to surface expression of the receptor and participates in transmembrane signaling through phosphorylation of its intracellular domain. Mutations in the GPIb beta subunit have been associated with Bernard-Soulier syndrome, velocardiofacial syndrome and giant platelet disorder. The 206 amino acid precursor of GPIb beta is synthesized from a 1.0 kb mRNA expressed in plateletes and megakaryocytes. A 411 amino acid protein arising from a longe ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000366425
  • ENSP00000383382
  • ENSG00000203618

Symbol
  • BS
  • CD42C
  • GPIBB
  • BDPLT1
  • GPIbbeta
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
0.78
PubMedID
0.65
tissue sample
0.64
phenotype
0.58
tissue
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 61.79   (req: < 5)
Gene RIFs: 36   (req: <= 3)
Antibodies: 136   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 61.79   (req: >= 5)
Gene RIFs: 36   (req: > 3)
Antibodies: 136   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (12)
Formation of Fibrin Clot (Clotting Cascade) (R-HSA-140877)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Formation of Fibrin Clot (Clotting Cascade)
Reactome
GP1b-IX-V activation signalling
Reactome
Hemostasis
Reactome
Intrinsic Pathway of Fibrin Clot Formation
Reactome
Platelet Adhesion to exposed collagen
Name
Explore in Pharos
Explore in Source
Formation of Fibrin Clot (Clotting Cascade)
GP1b-IX-V activation signalling
Hemostasis
Intrinsic Pathway of Fibrin Clot Formation
Platelet Adhesion to exposed collagen
Protein-Protein Interactions (93)
1 – 10 of 93
HAUS7
Tbio
Novelty: 1.2
p_int: 0.993537643
p_ni: 0.006462356
p_wrong: 2e-9
Data Source: BioPlex
HTR3A
Tclin
Family: IC
Novelty: 0.00035394
p_int: 0.981231418
p_ni: 0.018768581
p_wrong: 1e-9
Data Source: BioPlex
CHRNB4
Tclin
Family: IC
Novelty: 0.02388015
p_int: 0.973173825
p_ni: 0.026825646
p_wrong: 5.29e-7
Data Source: BioPlex
TMEM9
Tbio
Novelty: 0.1192335
p_int: 0.953321987
p_ni: 0.046671074
p_wrong: 0.000006939
Data Source: BioPlex
SLC39A12
Tbio
Family: Transporter
Novelty: 0.11255353
p_int: 0.952837976
p_ni: 0.047162007
p_wrong: 1.7e-8
Data Source: BioPlex
TSPAN17
Tdark
Novelty: 0.52282158
p_int: 0.947304826
p_ni: 0.052695157
p_wrong: 1.7e-8
Data Source: BioPlex
ZACN
Tchem
Family: IC
Novelty: 0.53571429
p_int: 0.945887304
p_ni: 0.054112675
p_wrong: 2.2e-8
Data Source: BioPlex
HTR3C
Tchem
Family: IC
Novelty: 0.1761544
p_int: 0.945254825
p_ni: 0.054745175
Data Source: BioPlex
VNN2
Tbio
Novelty: 0.02727863
p_int: 0.936240298
p_ni: 0.063759702
Score: 0.164
Data Source: BioPlex,STRINGDB
LRRC55
Tbio
Family: IC
Novelty: 0.37735849
p_int: 0.932115823
p_ni: 0.067879636
p_wrong: 0.000004541
Data Source: BioPlex
Publication Statistics
PubMed Score  61.79

PubMed score by year
PubTator Score  61.78

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGSGPRGALSLLLLLLAPPSRPAAGCPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTAL
1-70
PPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAA
70-140
CAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES
140-206
MGSGPRGALSLLLLLLAPPSRPAAGCPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES