You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IFITM1
Interferon-induced transmembrane protein 1

Protein Summary
Description
IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronavirus (SARS-CoV), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1) and hepatitis C virus (HCV). Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry and SARS-CoV S protein-mediated viral entry. Also implicated in cell adhesion and control of cell growth and migration. Plays a key role in the antiproliferative action of IFN-gamma either by inhibiting the ERK activation or by arresting cell growth in G1 phase in a p53-dependent manner. Acts as a positive regulator of osteoblast differentiation.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000328221
  • ENSP00000330825
  • ENSG00000185885
  • ENST00000408968
  • ENSP00000386187
  • ENST00000528780
  • ENSP00000437057

Symbol
  • CD225
  • IFI17
  • 9-27
  • CD225
  • IFI17
  • LEU13
  • DSPA2a
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
1
virus perturbation
1
small molecule perturbation
0.99
transcription factor perturbation
0.98
gene perturbation
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 140.44   (req: < 5)
Gene RIFs: 51   (req: <= 3)
Antibodies: 341   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 140.44   (req: >= 5)
Gene RIFs: 51   (req: > 3)
Antibodies: 341   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (10)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Reactome
Interferon Signaling
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Cytokine Signaling in Immune system
Immune System
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Interferon Signaling
Gene Ontology Terms (18)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (160)
1 – 10 of 160
MX1
Tbio
Novelty: 0.00081841
Score: 0.991
Data Source: STRINGDB
ISG15
Tbio
Novelty: 0.00256125
Score: 0.989
Data Source: STRINGDB
IFI6
Tbio
Novelty: 0.04401105
Score: 0.984
Data Source: STRINGDB
IFI35
Tbio
Novelty: 0.06821858
Score: 0.984
Data Source: STRINGDB
OAS2
Tbio
Family: Enzyme
Novelty: 0.03283444
Score: 0.983
Data Source: STRINGDB
IFITM2
Tbio
Novelty: 0.00509521
Score: 0.983
Data Source: STRINGDB
IFIT1
Tbio
Novelty: 0.00862855
Score: 0.979
Data Source: STRINGDB
IFIT3
Tbio
Novelty: 0.00899003
Score: 0.977
Data Source: STRINGDB
OAS1
Tbio
Family: Enzyme
Novelty: 0.00774033
Score: 0.975
Data Source: STRINGDB
CD81
Tchem
Novelty: 0.00157371
Score: 0.975
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  140.44

PubMed score by year
PubTator Score  102

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVG
1-70
DVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY
70-125
MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY