You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MLN
Promotilin

Protein Summary
Description
Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle. This gene encodes a small peptide hormone that is secreted by cells of the small intestine to regulate gastrointestinal contractions and motility. Proteolytic processing of the secreted protein produces the mature peptide and a byproduct referred to as motilin-associated peptide (MAP). Three transcript variants encoding different preproprotein isoforms but the same mature peptide have been found for this gene. [provided by RefSeq, May 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000266003
  • ENSP00000266003
  • ENSG00000096395
  • ENST00000430124
  • ENSP00000388825
  • ENST00000507738
  • ENSP00000425467
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
0.79
disease
0.61
pathway
0.5
tissue
0.5
phenotype
0.47


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1146.85   (req: < 5)
Gene RIFs: 10   (req: <= 3)
Antibodies: 200   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1146.85   (req: >= 5)
Gene RIFs: 10   (req: > 3)
Antibodies: 200   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (14)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Peptide ligand-binding receptors
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
G alpha (q) signalling events
GPCR downstream signalling
GPCR ligand binding
Peptide ligand-binding receptors
Gene Ontology Terms (4)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (199)
1 – 10 of 199
MLNR
Tchem
Family: GPCR
Novelty: 0.00643694
Score: 0.994
Data Source: Reactome,STRINGDB
GAST
Tbio
Novelty: 0.00012434
Score: 0.985
Data Source: STRINGDB
CCK
Tbio
Novelty: 0.00013779
Score: 0.974
Data Source: STRINGDB
NTS
Tbio
Novelty: 0.00035891
Score: 0.972
Data Source: STRINGDB
GHSR
Tclin
Family: GPCR
Novelty: 0.0018607
Score: 0.968
Data Source: STRINGDB
GCG
Tchem
Novelty: 0.00005614
Score: 0.965
Data Source: STRINGDB
TAC1
Tbio
Novelty: 0.00007711
Score: 0.965
Data Source: STRINGDB
GPR39
Tchem
Family: GPCR
Novelty: 0.01528618
Score: 0.963
Data Source: STRINGDB
GRP
Tbio
Novelty: 0.00039263
Score: 0.962
Data Source: STRINGDB
NMU
Tbio
Novelty: 0.00347523
Score: 0.958
Data Source: STRINGDB
Publication Statistics
PubMed Score  1146.85

PubMed score by year
PubTator Score  489.57

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVSRKAVAALLVVHVAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIR
1-70
EEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK
70-115
MVSRKAVAALLVVHVAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK