You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FCER1A
High affinity immunoglobulin epsilon receptor subunit alpha

Protein Classes
Protein Summary
Description
Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines. The immunoglobulin epsilon receptor (IgE receptor) is the initiator of the allergic response. When two or more high-affinity IgE receptors are brought together by allergen-bound IgE molecules, mediators such as histamine that are responsible for allergy symptoms are released. This receptor is comprised of an alpha subunit, a beta subunit, and two gamma subunits. The protein encoded by this gene represents the alpha subunit. [provided by RefSeq, Aug 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000368115
  • ENSP00000357097
  • ENSG00000179639

Symbol
  • FCE1A
  • FCE1A
  • FcERI
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.99
biological term
0.79
PubMedID
0.74
tissue sample
0.74
cell type or tissue
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 208.59   (req: < 5)
Gene RIFs: 94   (req: <= 3)
Antibodies: 625   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 208.59   (req: >= 5)
Gene RIFs: 94   (req: > 3)
Antibodies: 625   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (10)
1 – 5 of 10
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (110)
Fc epsilon receptor (FCERI) signaling (R-HSA-2454202)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Fc epsilon receptor (FCERI) signaling
Reactome
Immune System
Reactome
Innate Immune System
Name
Explore in Pharos
Explore in Source
Fc epsilon receptor (FCERI) signaling
Immune System
Innate Immune System
Gene Ontology Terms (5)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (126)
1 – 10 of 126
KDM8
Tbio
Family: Epigenetic
Novelty: 0.01809928
p_int: 0.999999655
p_ni: 3.45e-7
Data Source: BioPlex
CNNM1
Tdark
Novelty: 0.16670044
p_int: 0.999281826
p_ni: 0.000718172
p_wrong: 2e-9
Data Source: BioPlex
ARFGEF3
Tdark
Novelty: 0.24432062
p_int: 0.996187272
p_ni: 0.002735683
p_wrong: 0.001077045
Data Source: BioPlex
ERN1
Tchem
Family: Kinase
Novelty: 0.00324545
p_int: 0.993907984
p_ni: 0.005875019
p_wrong: 0.000216997
Data Source: BioPlex
STX6
Tbio
Novelty: 0.01577464
p_int: 0.991837113
p_ni: 0.007895814
p_wrong: 0.000267073
Data Source: BioPlex
MFAP3
Tdark
Novelty: 1.07142857
p_int: 0.983759167
p_ni: 0.015573859
p_wrong: 0.000666975
Data Source: BioPlex
SRC
Tclin
Family: Kinase
Novelty: 0.00009742
p_int: 0.980910045
p_ni: 0.019088791
p_wrong: 0.000001164
Score: 0.238
Data Source: BioPlex,STRINGDB
NDFIP1
Tbio
Novelty: 0.05005263
p_int: 0.974716905
p_ni: 0.023582165
p_wrong: 0.00170093
Data Source: BioPlex
FAHD2A
Tdark
Family: Enzyme
Novelty: 0.68965517
p_int: 0.974000527
p_ni: 0.025999472
p_wrong: 1e-9
Data Source: BioPlex
LTN1
Tbio
Family: Enzyme
Novelty: 0.02877501
p_int: 0.970857982
p_ni: 0.029142018
Data Source: BioPlex
Publication Statistics
PubMed Score  208.59

PubMed score by year
PubTator Score  605.27

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSL
1-70
SEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDV
70-140
YKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQFFIPL
140-210
LVVILFAVDTGLFISTQQQVTFLLKIKRTRKGFRLLNPHPKPNPKNN
210-257
MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQFFIPLLVVILFAVDTGLFISTQQQVTFLLKIKRTRKGFRLLNPHPKPNPKNN